KEGG   Paracoccidioides lutzii Pb01: PAAG_05865Help
Entry
PAAG_05865        CDS       T02230                                 

Definition
(RefSeq) glycogen synthase kinase-3 beta
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PAAG_05865
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAAG_05865
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PAAG_05865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1483 aa AA seqDB search
MPLQKATPPPRGPQPTSSSPSHNDDSGSGGRDLPVQPMSCSSANIQAAKTNRRVQTAEAS
SRRVQKNPSSGSMTDSSNSSSLLFRNNVERTGNGVSIRRRQSIRDRDQNPNFGSRQGDPV
KRSFPNYSNPQTHSANPSIQSSSSHGHGHGHGRTGNNSSRLSFNFVTPSDLAQDESRTPP
DSSEFLAPINFDDFHNSIMSKEPNLSHFPLPSAISYDSKPLAPRSTPRWSNQQPPQNVNH
VRTAPFSRRASNASRSTVGSVSTVNGNEKPQAPSAARARRLSHALPPSSGVMATTTTTAR
PPRKSIGPGSLVTDAGDPGVPRRRPSLSTRKNTVDANRSAQHPFSLQMATQQSMDAGPSE
SSMFLNTPRNQKAKSLQPPLRVPRESLIIPSTSSEPSRSLSNSGVRSPGKAAQNRTTTPS
SSSKRVSTMPPHAHGLGARTISPTDARRMKRMSLMPQPPPMPHTPPTQQDATLPPTRSSA
QSPSMIPRKSVTPSSTRTTPDPHRKSYSSGISLSSNTSNNSARNSNGSLQPRLSQNVSTS
RLPTPKPRTENSSNNEEEEVPPVPAIPKAYESPKTEGELQLSVTRKSSLPLDAGRSRVSS
RLDSDSVDTPSKRPILDDFQVTRAIIHRADSKPRPASNVGRKNLQPLKLPPLNLLPLSIP
MTNKIKSLRDKGAQDSNMRVFSTPPPLLPLTKTPTTPMTASKVSFFSHGILDQEPLPSPQ
PRSTSSHYSLRNDPVRFRAQNSSSALGPLDVASDSRSVSPYVLTSIPGTKPEFTHTRPEY
SRTNSNRLTGPRPQTQFATISPRVEPSNFVLQPSTDNGSESSLPSSTRRDARGDHYRAKS
HHIITEPINDPSKHGSMPPPKLPASATWNNLSSTRQSPNSKPAYIQTRRKASTSSVTNGI
TLRNQSVSSEQSLALNPSSSIDAGETESQPSRSSSLLSPVHKLLSNSKSPPCKLHPQDQN
LDRDYISAEEEMRKLGSKRKDFESAVRELDELRRRANPKERVGPAQALKMATLNIFEKGE
IIDFKDIYFCGTHKAKKHVGDLNAQSANFGYDDERGDYNIVLGDHLAYRYEIVDILGKGS
FGQVVRCVDHKTGALVAVKIIRNKKRFHQQALVEVNILQKLKEWDPNRRHSVVNFTQSFY
FRGHLCISTELLGMNLYEFIKAHDFRGFSLKLIRRFTKQLLSTLVLLHKHKVIHCDLKPE
NVLLAHPMHSEIKVIDFGSSCFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMWSVGCIL
AELFTGYPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRRKLFFDSLGKPRLTVSSKGRR
RKPSSKELRQVLKCDDEAFLDFIARCLRWDPNRRLTPNDALNHEFITGIKSNPRSRVHLV
SVNSPAKRMASGPASSTIRPLPDPPSFATKSGGRVRDSSSQSPIKNTGPKRSSTISTAST
VNSISKRTSNGNPISGSALPRVSRAASGKADLATAAAAASLVS
NT seq 4452 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgcagaaagctacaccgccgccacgaggtccgcagcccacatcctccagccct
tctcacaacgatgattctggttctggaggtagggatttgcccgttcagccaatgtcctgc
tcttcagccaatatacaggccgcgaagactaacaggcgggtgcaaacagcggaggcttcg
tcgcgaagggtgcagaaaaacccgtcttcggggagcatgacggacagctccaattccagc
tccttacttttcagaaacaacgtggagcgtactgggaatggtgtttcgattcgcagacga
cagtcgatacgagatcgggatcagaacccgaattttggctcccgacagggagatcctgta
aaacgatcctttcccaattattctaacccacaaacacattcagcaaatccttccatacag
tcctcctcgtctcatgggcatgggcatgggcatgggcgcacgggaaacaacagctctcgt
ttaagtttcaacttcgttacgcccagcgatctggcccaggacgagagtcgcactcctcca
gatagcagtgaatttctcgcccccatcaatttcgacgatttccacaatagcatcatgtcg
aaagaaccaaatttgagccatttccctcttccttcggcaatcagctacgattcaaaacct
ctggctccccgatcaacaccacgatggtcaaaccagcagccaccgcaaaacgtgaatcac
gttcggacagcgccgttctcccggcgagcaagcaatgcatcgaggagtacagtggggagt
gtatctacagtaaatggaaatgaaaaacctcaggcacccagtgccgctcgcgcacgtcga
ttgagccatgcccttccgccttcctctggcgtcatggcaacaacgacgacgacggcgcga
ccgcctagaaaatccattggaccggggagtttagttacagacgccggggaccccggtgtc
ccacgacgaagaccaagtttgtcgacaaggaaaaatacggtggacgctaatcgttcggct
cagcatcctttttctttgcagatggcaacccaacaaagcatggatgcaggtccttctgaa
tcttcaatgtttttaaatacacctagaaaccagaaagcaaaatcactgcaaccacctctg
cgggtgcccagagagagtttaattatcccatccactagctcagaaccttcgaggtctctg
tcaaatagtggtgtgcgaagcccaggcaaggcagcgcagaaccggacaactactccttca
tcgtcgtcgaagcgggtgtcgactatgccccctcatgctcacggtttaggagcacgaaca
attagccccaccgatgccaggcgtatgaaacgaatgtcattgatgccccaacctccgcca
atgccacatacacctccgacacagcaagatgccacgctccctccgacccgctcttcagcc
cagtctccttccatgatacccaggaaaagcgttactccttcctccaccaggaccacgcca
gacccgcatcgcaaatcctacagttcagggatatctttgtcttccaataccagtaataat
tctgctcgaaattctaacgggtctttgcagccaagactgtcccagaatgtttcaacatct
agactaccaactcccaaaccacgtactgaaaactcatcgaataatgaagaggaagaagtt
cccccagttccagccattcccaaggcgtacgaatcgcccaagactgaaggagagctccag
ctttccgtcactcgaaaatccagtctacccctagacgctggacgatcaagagtcagctca
agattagactccgattccgtcgatactcctagtaaaaggcctatattagatgatttccaa
gttaccagagcaattatccaccgggcggattccaaacctagacctgcctcaaatgttggc
agaaaaaaccttcaaccactgaagctcccgccccttaatctactgcctctaagcattcct
atgacgaacaaaattaaatctttgagagataaaggcgcacaagattcaaacatgcgtgtc
tttagcacacccccacccctcctgcccttgaccaaaaccccaaccactccaatgacagct
tcaaaggtcagcttcttttctcatggtatactcgatcaagagccactgccatcaccgcaa
ccgaggagcactagttcgcattattcactccgcaacgatccagtccgattccgggctcaa
aatagttccagtgccctcggcccattggacgttgcctccgacagcaggagtgtttctcct
tatgttttgacgtccataccaggaacgaagccagagtttactcatacacgacccgagtat
tccaggaccaattctaataggctgactggaccccggcctcaaactcagtttgctactatt
tctccgcgtgttgagccgtcgaactttgttctgcaaccgagtacagataacggatctgag
agtagcctcccgtcttccacccgacgggacgccagaggtgatcactatagagcgaaatct
caccatattatcacggaaccaatcaatgatccctccaagcatggcagcatgcctcctccg
aaacttccggcgtcagctacttggaataacctgtcaagtactagacaaagccctaattcc
aaacctgcatatatacagaccagacgtaaagcgtccacgtcaagtgtcacaaatggtatt
actctgcggaaccaaagcgtcagcagcgaacagagtctggctcttaaccccagttcctcc
attgatgccggcgaaactgagagtcagcccagtcggtcatcgtctttattatctcctgtg
cataaactcctctcaaactccaaatcccctccttgcaagcttcaccctcaggatcagaat
cttgatcgggactatatatcagccgaagaagagatgcggaaactaggtagtaaacggaaa
gatttcgaaagtgccgtaagggagctagacgagttgcgaagacgggcaaaccctaaggag
cgagttggacccgcacaggctctaaagatggctactttgaacatattcgagaaaggcgaa
attattgacttcaaggatatctatttctgcggcacgcacaaggcgaagaaacatgttggt
gatcttaatgcgcaaagtgccaattttggttacgacgatgagcgtggcgattacaatatc
gtccttggagaccatcttgcgtaccgttatgaaattgtcgatatcttgggcaaggggagt
tttggtcaagtggtacgatgcgttgaccataaaacaggggccctcgttgcggtgaaaatc
atcaggaataaaaagcgattccatcagcaggcgttggttgaagtgaatatcctacaaaag
cttaaggaatgggatcccaaccgacgccacagcgttgtgaactttactcaaagcttttac
ttccgtgggcacctttgtatatcgacagaacttctaggcatgaatctgtatgagtttatc
aaagctcatgatttcagaggcttttcgcttaaactcatccgccggtttacgaagcagctg
ctcagcactttggttcttttgcacaagcacaaggtcattcactgtgacctgaaaccagag
aatgtgcttcttgctcaccctatgcattcggaaatcaaagtgattgactttggctcgagt
tgtttcgaaaatgagaaagtgtacacttacatacagagtcgcttttatcgctcccctgaa
gttattttgggcatgtcgtacggaatgcccattgacatgtggagcgtgggctgtatccta
gctgaattattcactggctaccccattttccctggtgaaaacgaacaagagcagttggca
tgtatcatggaggtgttcggaccccccgaaaaacatcttatcgaaaagagcacacggaga
aagcttttcttcgactcactcggcaagcctcgtctgactgtctcatccaagggtagaaga
agaaagccaagctccaaggaactccgccaagtcctaaaatgcgacgatgaagctttcctc
gactttatagctcgctgtttgcgatgggatccaaacagacgcctcactcccaacgacgcc
ttaaaccacgagttcatcaccggcatcaaatccaacccgcgatcacgagtccatctcgtc
tcggtcaactcgccagcaaaacgcatggcttcaggaccggcctcatcaaccatccgaccg
cttcccgatcccccatccttcgccaccaagagtggagggcgagttcgagattcgtcaagc
cagtctcccattaagaatacaggtcctaaacggagttcaactatcagcactgcctccacg
gtaaacagtataagcaagcgaacgtcgaatggaaatccaatatccggctccgctctgcca
cgggtctcgagagctgctagtgggaaagcggatctggcaacagcggcagcggcagccagc
ctggtaagctga

DBGET integrated database retrieval system