KEGG   Paracoccidioides brasiliensis: PAAG_05865Help
Entry
PAAG_05865        CDS       T02230                                 

Definition
glycogen synthase kinase-3 beta
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAAG_05865
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PAAG_05865
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1442 aa AA seqDB search
MPLQKATPPPRGPQPTSSSPSHNDDSGSGGRDLPVQPMSCSSANIQAAKTNRRVQTAEAS
SRRVQKNPSSGSMTDSSNSSSLLFRNNVERTGNANPSIQSSSSHGHGHGHGRTGNNSSRL
SFNFVTPSDLAQDESRTPPDSSEFLAPINFDDFHNSIMSKEPNLSHFPLPSAISYDSKPL
APRSTPRWSNQQPPQNVNHVRTAPFSRRASNASRSTVGSVSTVNGNEKPQAPSAARARRL
SHALPPSSGVMATTTTTARPPRKSIGPGSLVTDAGDPGVPRRRPSLSTRKNTVDANRSAQ
HPFSLQMATQQSMDAGPSESSMFLNTPRNQKAKSLQPPLRVPRESLIIPSTSSEPSRSLS
NSGVRSPGKAAQNRTTTPSSSSKRVSTMPPHAHGLGARTISPTDARRMKRMSLMPQPPPM
PHTPPTQQDATLPPTRSSAQSPSMIPRKSVTPSSTRTTPDPHRKSYSSGISLSSNTSNNS
ARNSNGSLQPRLSQNVSTSRLPTPKPRTENSSNNEEEEVPPVPAIPKAYESPKTEGELQL
SVTRKSSLPLDAGRSRVSSRLDSDSVDTPSKRPILDDFQVTRAIIHRADSKPRPASNVGR
KNLQPLKLPPLNLLPLSIPMTNKIKSLRDKGAQDSNMRVFSTPPPLLPLTKTPTTPMTAS
KVSFFSHGILDQEPLPSPQPRSTSSHYSLRNDPVRFRAQNSSSALGPLDVASDSRSVSPY
VLTSIPGTKPEFTHTRPEYSRTNSNRLTGPRPQTQFATISPRVEPSNFVLQPSTDNGSES
SLPSSTRRDARGDHYRAKSHHIITEPINDPSKHGSMPPPKLPASATWNNLSSTRQSPNSK
PAYIQTRRKASTSSVTNGITLRNQSVSSEQSLALNPSSSIDAGETESQPSRSSSLLSPVH
KLLSNSKSPPCKLHPQDQNLDRDYISAEEEMRKLGSKRKDFESAVRELDELRRRANPKER
VGPAQALKMATLNIFEKGEIIDFKDIYFCGTHKAKKHVGDLNAQSANFGYDDERGDYNIV
LGDHLAYRYEIVDILGKGSFGQVVRCVDHKTGALVAVKIIRNKKRFHQQALVEVNILQKL
KEWDPNRRHSVVNFTQSFYFRGHLCISTELLGMNLYEFIKAHDFRGFSLKLIRRFTKQLL
STLVLLHKHKVIHCDLKPENVLLAHPMHSEIKVIDFGSSCFENEKVYTYIQSRFYRSPEV
ILGMSYGMPIDMWSVGCILAELFTGYPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRRK
LFFDSLGKPRLTVSSKGRRRKPSSKELRQVLKCDDEAFLDFIARCLRWDPNRRLTPNDAL
NHEFITGIKSNPRSRVHLVSVNSPAKRMASGPASSTIRPLPDPPSFATKSGGRVRDSSSQ
SPIKNTGPKRSSTISTASTVNSISKRTSNGNPISGSALPRVSRAASGKADLATAAAAASL
VS
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgcagaaagctacaccgccgccacgaggtccgcagcccacatcctccagccct
tctcacaacgatgattctggttctggaggtagggatttgcccgttcagccaatgtcctgc
tcttcagccaatatacaggccgcgaagactaacaggcgggtgcaaacagcggaggcttcg
tcgcgaagggtgcagaaaaacccgtcttcggggagcatgacggacagctccaattccagc
tccttacttttcagaaacaacgtggagcgtactgggaatgcaaatccttccatacagtcc
tcctcgtctcatgggcatgggcatgggcatgggcgcacgggaaacaacagctctcgttta
agtttcaacttcgttacgcccagcgatctggcccaggacgagagtcgcactcctccagat
agcagtgaatttctcgcccccatcaatttcgacgatttccacaatagcatcatgtcgaaa
gaaccaaatttgagccatttccctcttccttcggcaatcagctacgattcaaaacctctg
gctccccgatcaacaccacgatggtcaaaccagcagccaccgcaaaacgtgaatcacgtt
cggacagcgccgttctcccggcgagcaagcaatgcatcgaggagtacagtggggagtgta
tctacagtaaatggaaatgaaaaacctcaggcacccagtgccgctcgcgcacgtcgattg
agccatgcccttccgccttcctctggcgtcatggcaacaacgacgacgacggcgcgaccg
cctagaaaatccattggaccggggagtttagttacagacgccggggaccccggtgtccca
cgacgaagaccaagtttgtcgacaaggaaaaatacggtggacgctaatcgttcggctcag
catcctttttctttgcagatggcaacccaacaaagcatggatgcaggtccttctgaatct
tcaatgtttttaaatacacctagaaaccagaaagcaaaatcactgcaaccacctctgcgg
gtgcccagagagagtttaattatcccatccactagctcagaaccttcgaggtctctgtca
aatagtggtgtgcgaagcccaggcaaggcagcgcagaaccggacaactactccttcatcg
tcgtcgaagcgggtgtcgactatgccccctcatgctcacggtttaggagcacgaacaatt
agccccaccgatgccaggcgtatgaaacgaatgtcattgatgccccaacctccgccaatg
ccacatacacctccgacacagcaagatgccacgctccctccgacccgctcttcagcccag
tctccttccatgatacccaggaaaagcgttactccttcctccaccaggaccacgccagac
ccgcatcgcaaatcctacagttcagggatatctttgtcttccaataccagtaataattct
gctcgaaattctaacgggtctttgcagccaagactgtcccagaatgtttcaacatctaga
ctaccaactcccaaaccacgtactgaaaactcatcgaataatgaagaggaagaagttccc
ccagttccagccattcccaaggcgtacgaatcgcccaagactgaaggagagctccagctt
tccgtcactcgaaaatccagtctacccctagacgctggacgatcaagagtcagctcaaga
ttagactccgattccgtcgatactcctagtaaaaggcctatattagatgatttccaagtt
accagagcaattatccaccgggcggattccaaacctagacctgcctcaaatgttggcaga
aaaaaccttcaaccactgaagctcccgccccttaatctactgcctctaagcattcctatg
acgaacaaaattaaatctttgagagataaaggcgcacaagattcaaacatgcgtgtcttt
agcacacccccacccctcctgcccttgaccaaaaccccaaccactccaatgacagcttca
aaggtcagcttcttttctcatggtatactcgatcaagagccactgccatcaccgcaaccg
aggagcactagttcgcattattcactccgcaacgatccagtccgattccgggctcaaaat
agttccagtgccctcggcccattggacgttgcctccgacagcaggagtgtttctccttat
gttttgacgtccataccaggaacgaagccagagtttactcatacacgacccgagtattcc
aggaccaattctaataggctgactggaccccggcctcaaactcagtttgctactatttct
ccgcgtgttgagccgtcgaactttgttctgcaaccgagtacagataacggatctgagagt
agcctcccgtcttccacccgacgggacgccagaggtgatcactatagagcgaaatctcac
catattatcacggaaccaatcaatgatccctccaagcatggcagcatgcctcctccgaaa
cttccggcgtcagctacttggaataacctgtcaagtactagacaaagccctaattccaaa
cctgcatatatacagaccagacgtaaagcgtccacgtcaagtgtcacaaatggtattact
ctgcggaaccaaagcgtcagcagcgaacagagtctggctcttaaccccagttcctccatt
gatgccggcgaaactgagagtcagcccagtcggtcatcgtctttattatctcctgtgcat
aaactcctctcaaactccaaatcccctccttgcaagcttcaccctcaggatcagaatctt
gatcgggactatatatcagccgaagaagagatgcggaaactaggtagtaaacggaaagat
ttcgaaagtgccgtaagggagctagacgagttgcgaagacgggcaaaccctaaggagcga
gttggacccgcacaggctctaaagatggctactttgaacatattcgagaaaggcgaaatt
attgacttcaaggatatctatttctgcggcacgcacaaggcgaagaaacatgttggtgat
cttaatgcgcaaagtgccaattttggttacgacgatgagcgtggcgattacaatatcgtc
cttggagaccatcttgcgtaccgttatgaaattgtcgatatcttgggcaaggggagtttt
ggtcaagtggtacgatgcgttgaccataaaacaggggccctcgttgcggtgaaaatcatc
aggaataaaaagcgattccatcagcaggcgttggttgaagtgaatatcctacaaaagctt
aaggaatgggatcccaaccgacgccacagcgttgtgaactttactcaaagcttttacttc
cgtgggcacctttgtatatcgacagaacttctaggcatgaatctgtatgagtttatcaaa
gctcatgatttcagaggcttttcgcttaaactcatccgccggtttacgaagcagctgctc
agcactttggttcttttgcacaagcacaaggtcattcactgtgacctgaaaccagagaat
gtgcttcttgctcaccctatgcattcggaaatcaaagtgattgactttggctcgagttgt
ttcgaaaatgagaaagtgtacacttacatacagagtcgcttttatcgctcccctgaagtt
attttgggcatgtcgtacggaatgcccattgacatgtggagcgtgggctgtatcctagct
gaattattcactggctaccccattttccctggtgaaaacgaacaagagcagttggcatgt
atcatggaggtgttcggaccccccgaaaaacatcttatcgaaaagagcacacggagaaag
cttttcttcgactcactcggcaagcctcgtctgactgtctcatccaagggtagaagaaga
aagccaagctccaaggaactccgccaagtcctaaaatgcgacgatgaagctttcctcgac
tttatagctcgctgtttgcgatgggatccaaacagacgcctcactcccaacgacgcctta
aaccacgagttcatcaccggcatcaaatccaacccgcgatcacgagtccatctcgtctcg
gtcaactcgccagcaaaacgcatggcttcaggaccggcctcatcaaccatccgaccgctt
cccgatcccccatccttcgccaccaagagtggagggcgagttcgagattcgtcaagccag
tctcccattaagaatacaggtcctaaacggagttcaactatcagcactgcctccacggta
aacagtataagcaagcgaacgtcgaatggaaatccaatatccggctccgctctgccacgg
gtctcgagagctgctagtgggaaagcggatctggcaacagcggcagcggcagccagcctg
gtaagctga

DBGET integrated database retrieval system