KEGG   Paracoccidioides lutzii Pb01: PAAG_05910Help
Entry
PAAG_05910        CDS       T02230                                 

Definition
(RefSeq) dolichyl-phosphate-mannose-protein mannosyltransferase
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PAAG_05910
Enzymes [BR:pbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     PAAG_05910
Glycosyltransferases [BR:pbl01003]
 O-Glycan biosynthesis
  O-linked Man type
   PAAG_05910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 948 aa AA seqDB search
MTSKSPRGGLGVEPHTRKGRSPSRSPNSKSRKKAAASKNSHYGSEGVSDHDVLQLPVSDY
KIMLRLTALAFVVRLFRIYQPTSVVFDEVHFGGFATKYIKGKFFMDVHPPLAKMLIALVG
YLAGFRGDFDFKNIGKDYLEPGVPYVAMRMLPALMGIMAVPTMFLTLKAYGCRTSTASMG
ALLITFENALTTQSRFILLDSPLIFFTALTSLAFTNFTNQHEQGPSKAFEASWWFWLILT
GIFLGATLSVKWVGLFTIAWVGSLTILQLWVLLGDTRTVTVRIWFKHFFARVLCLIVLPV
AFYVAMFQIHFICLVNPGDGDGFMSSEFQSTLNSKAMEDVPADVAFGSRVSIRHYNTQGG
YLHSHSSMYPAGSKQQQVTLYPHQDDNNLWIIENNTQPLGDYGEVQGPTAWDNITASNII
DGSVIKVYHLSTNRRLHSHDVRPPVTDADWQNEVSAYGYEGFPGDANDLFRVEIVKSMSD
GDEAKKRLRTIQTKFRLIHHMTGCVLFSHKVKLPQWGFEQQEVTCAKGGTLPNSIWYIEG
NDHPMLGPDAEKVNYKRPGFFSKFWELQKVMWRTNAGLVESHAWDSRPPSWPTLSRGINF
WSRDYRQVYLIGNPLIWWSSTLAILFYVIFKGLATLRWQRGCDDYKNVNFKRFDYELGQT
VLGWAFHYFPFYLMARQLFLHHYLPALYFAILAFCQIVDYGVNRVTLTGFRSKPVLGKIF
MFLFVTLSIVVFALFSPLIYGNPWTKAACGRVKLLDTWDFDCNLFHDKLSQYETPIDFVN
DAEQLASPTSAPQGQEQEEELLPLPAQQQEQNGNSGEVPDNAMVTSAQTMEHTNSHVVEY
RDQDGNILNDEQVALLQKEGHVSFETKYETRTRLIDAQGHGVGREPPAPQHPDAEGQNPE
TSSKGDTGELPNNKPARELSDEKFVETDAGKPKPASEGHEATKRDDGN
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaagtcgcccagaggcgggctgggggtggaacctcacacgcgcaaaggccgt
tctccctcccgatcccccaattctaagagcaggaagaaggcagcggcatcgaagaattcc
cactacggctctgaaggagtttcagatcatgatgtgcttcaactaccggtctccgattac
aaaattatgctccggttgacagcgctggccttcgtggtgcgactattcaggatctaccag
ccgacaagtgttgtgtttgatgaagtgcacttcggtgggtttgcgacgaagtatatcaag
ggcaaattcttcatggacgtgcacccaccgctggctaaaatgcttattgcccttgtcgga
tacttggccggatttcgtggtgacttcgactttaaaaatattgggaaagattacttggaa
ccgggcgttccgtacgtggctatgcgcatgttacccgccttaatgggtataatggctgtt
ccgacgatgttccttactctgaaagcatatggctgccgaacttctacagcttcaatgggc
gcattgcttattacattcgaaaacgcactgacgacccagtcccggtttatccttctcgat
tcacctctgatcttttttaccgcccttacctcactcgcctttacaaactttacaaaccag
catgagcaagggccttcaaaggcattcgaagcatcatggtggttttggctcattcttaca
ggcatcttcttgggcgccactcttagtgtaaagtgggtgggtctttttaccatcgcctgg
gtgggaagtttgacaatccttcagctctgggttctgcttggagataccagaacagtcact
gtccgtatctggtttaaacacttttttgcgagagtactctgtctcatcgttctcccagtt
gcgttctatgtggccatgtttcagattcacttcatatgcttggtcaaccctggtgatgga
gatggttttatgtcttccgaattccagtcgaccctcaactccaaagcaatggaggatgtt
ccagctgatgtagcctttggctcaagagtctctatccgccattacaatactcagggcggg
tatttgcattcacattcttctatgtatcccgcgggcagcaagcaacagcaagtcactctg
tacccccaccaggatgacaataacctctggatcattgagaacaacacccagccgttgggc
gactacggggaagttcagggcccaaccgcctgggataacataaccgctagcaacattata
gacggatcagttatcaaggtttaccacctctctacgaaccgaagacttcattcccatgac
gttcgccctcccgtaacagacgctgattggcagaacgaggtatctgcgtatggttacgaa
gggtttcctggtgatgcaaatgaccttttccgcgttgagattgtcaaatcgatgtccgac
ggcgacgaagccaagaaacgactccgcacaatccagacaaagttcaggctcatccaccat
atgaccggatgcgtactattttcacacaaggtgaagcttccacaatggggatttgaacag
caagaagtcacatgcgccaaaggcgggactctccccaatagcatttggtacattgaggga
aatgaccatccaatgctcggaccagacgccgagaaagtcaactacaagaggcctgggttc
tttagcaagttctgggaattgcagaaggttatgtggaggacaaacgctggcctcgtcgaa
tcccacgcgtgggattccagacctccctcctggccgacactttcacgaggtatcaatttc
tggagcagagactaccgccaggtttacctaattggtaacccccttatttggtggtcttca
acccttgcaatactgttttacgtcatcttcaaaggtcttgctactctgcgctggcaacga
ggttgcgatgattataagaatgtgaacttcaaacgcttcgattatgagcttggacaaact
gtccttggatgggctttccactacttcccattctatctcatggcacgccagctgttcctc
caccattatttaccagcgctctactttgccatccttgcgttctgccagattgtcgattat
ggggtaaacagggtcaccttgacggggttcagaagcaaacctgtactcgggaagatattc
atgtttctctttgttacgctatcgattgttgttttcgcccttttctcgccattgatctac
ggcaacccttggaccaaggctgcgtgcggtagagtcaagcttctcgacacgtgggatttc
gattgcaaccttttccacgacaagctgtctcaatatgagacaccaatcgactttgtcaat
gacgctgaacaacttgcttccccaacttctgctccccaggggcaggagcaagaagaagag
ctgctgccactaccagcgcaacaacaggagcaaaatggtaactcaggtgaagtaccagac
aatgcaatggtgacttccgcccaaacgatggaacataccaattcccatgtcgtggaatat
cgtgaccaggacggaaatatcttgaacgacgagcaggtagcgttgctgcaaaaggagggt
cacgtctcgtttgaaaccaaatacgaaacacggacgagattaattgatgcacagggccac
ggggtgggccgggaacctcctgcacctcaacaccctgatgctgaggggcagaatcctgaa
acgtctagcaagggcgacactggcgagttgccgaataacaagcctgcacgcgaacttagt
gatgagaagtttgtggagacggatgcaggtaagcccaagcctgcaagtgaagggcatgag
gctacgaagagggatgatggaaattga

DBGET integrated database retrieval system