KEGG   Paracoccidioides brasiliensis: PAAG_05915Help
Entry
PAAG_05915        CDS       T02230                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pbl00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 510 aa AA seqDB search
MGSANESFVGSIDQGTTSSRFLIFSPAGEVVASHQLEFRQIYSQPGWHEHDPLEIVGSVE
KCIDGAVASFESQGHSIQSIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQTLVRK
LKNRLGANELQDLCGLPLSTYPSVGKLLWMIENVRKVKEAYEKGELAFGTVDTWLVYRLN
GGTKRDIYVTDASNASRTMFMNIKTLQYDDHLIEFFRLDRDKVHLPKIIHSSDPEGYGSL
ASTALRGLPITGCLGDQSAALVGQKGFTPGLAKNTYGTGCFLLYNIGETPVISKHGLLTT
VAYDFNGKVMYALEGSIAVGGSSVKFLVNNFGFIDKSSDISALAETVEDSGGLVFVTAFS
GLFAPYWMDDARGTMFGITTYTQRGHVARATLEATCFQTKAILDAMEKDSGQKLTELAVD
GGMCNSDLTMQTQSDIISIPVHRPAMRETTALGAAIAAGLAIGIWHGLEELATVNTEGRT
VFTPAIPKEQATSRFSKWEKAVQMCKGWAN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggggagcgccaatgaatcattcgtgggttctatcgaccagggaacgacaagctcgaga
ttcctcatatttagccctgcgggggaggtcgttgcgtcgcatcaactcgagttccgacag
atatattctcagcctggctggcacgaacatgaccccctggaaatagttgggtcggtcgag
aaatgcatagacggtgccgttgcttctttcgaaagtcagggccatagcatccaatctata
aaagcaattggcattacgaatcagcgagagaccaccgtggtgtgggatagaaagaccggg
gagccactctacaacgcgattgtatggacagacacgcgcacccagacgctggttcgcaag
ctgaagaatcgcctcggggcgaatgagctgcaggacctttgtggtcttccattatcgaca
tatccatctgttggcaagctactctggatgatcgagaatgttcgcaaggtcaaagaagcc
tatgaaaagggcgagcttgcctttgggaccgttgacacttggctcgtctacaggctcaat
ggcgggacaaagagggatatctatgtcactgatgcttcaaatgcgtcacgaacaatgttt
atgaacatcaaaaccctccagtatgacgaccatcttatcgaattcttccgtctcgacagg
gataaagttcatcttcccaaaatcatccactcgtcagacccagaaggatacggctctcta
gcatccactgccctgagggggctccctattacaggctgtctaggtgaccagtctgcagcc
cttgttggccaaaagggcttcactccaggccttgcgaaaaacacatatggtacaggatgc
ttcttgctatacaacataggtgaaacccccgtaatatccaaacacggcctattaactact
gtcgcctatgacttcaatgggaaagtaatgtatgcgctcgaagggagcattgctgttggc
ggatctagcgtgaaattcttagtgaacaacttcggcttcatcgacaaatccagtgacatc
agtgctctggcagagacagtcgaagatagtggtggtcttgtgtttgtaactgcttttagc
ggtttgttcgcaccatactggatggatgacgcacgcggcacgatgtttggaatcactacc
tacacacagcgtggacatgtggcccgcgcgacgcttgaggcaacatgtttccaaacaaag
gctatccttgacgccatggagaaggatagcggccaaaaattgacagaattagctgttgac
gggggcatgtgtaatagtgatttgactatgcagacccaatctgacatcatttccattccc
gtccaccggcccgcaatgcgagaaaccaccgctctcggtgctgcaattgcagcaggtctg
gcgattggcatctggcacggacttgaagaattagctaccgtgaataccgaaggccggact
gttttcacgccggccattcccaaggaacaggctacaagtcgattttcgaaatgggagaag
gctgtccaaatgtgcaaaggttgggctaattga

DBGET integrated database retrieval system