KEGG   Paracoccidioides brasiliensis: PAAG_05915Help
Entry
PAAG_05915        CDS       T02230                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PAAG_05915
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PAAG_05915
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAAG_05915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 510 aa AA seqDB search
MGSANESFVGSIDQGTTSSRFLIFSPAGEVVASHQLEFRQIYSQPGWHEHDPLEIVGSVE
KCIDGAVASFESQGHSIQSIKAIGITNQRETTVVWDRKTGEPLYNAIVWTDTRTQTLVRK
LKNRLGANELQDLCGLPLSTYPSVGKLLWMIENVRKVKEAYEKGELAFGTVDTWLVYRLN
GGTKRDIYVTDASNASRTMFMNIKTLQYDDHLIEFFRLDRDKVHLPKIIHSSDPEGYGSL
ASTALRGLPITGCLGDQSAALVGQKGFTPGLAKNTYGTGCFLLYNIGETPVISKHGLLTT
VAYDFNGKVMYALEGSIAVGGSSVKFLVNNFGFIDKSSDISALAETVEDSGGLVFVTAFS
GLFAPYWMDDARGTMFGITTYTQRGHVARATLEATCFQTKAILDAMEKDSGQKLTELAVD
GGMCNSDLTMQTQSDIISIPVHRPAMRETTALGAAIAAGLAIGIWHGLEELATVNTEGRT
VFTPAIPKEQATSRFSKWEKAVQMCKGWAN
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggggagcgccaatgaatcattcgtgggttctatcgaccagggaacgacaagctcgaga
ttcctcatatttagccctgcgggggaggtcgttgcgtcgcatcaactcgagttccgacag
atatattctcagcctggctggcacgaacatgaccccctggaaatagttgggtcggtcgag
aaatgcatagacggtgccgttgcttctttcgaaagtcagggccatagcatccaatctata
aaagcaattggcattacgaatcagcgagagaccaccgtggtgtgggatagaaagaccggg
gagccactctacaacgcgattgtatggacagacacgcgcacccagacgctggttcgcaag
ctgaagaatcgcctcggggcgaatgagctgcaggacctttgtggtcttccattatcgaca
tatccatctgttggcaagctactctggatgatcgagaatgttcgcaaggtcaaagaagcc
tatgaaaagggcgagcttgcctttgggaccgttgacacttggctcgtctacaggctcaat
ggcgggacaaagagggatatctatgtcactgatgcttcaaatgcgtcacgaacaatgttt
atgaacatcaaaaccctccagtatgacgaccatcttatcgaattcttccgtctcgacagg
gataaagttcatcttcccaaaatcatccactcgtcagacccagaaggatacggctctcta
gcatccactgccctgagggggctccctattacaggctgtctaggtgaccagtctgcagcc
cttgttggccaaaagggcttcactccaggccttgcgaaaaacacatatggtacaggatgc
ttcttgctatacaacataggtgaaacccccgtaatatccaaacacggcctattaactact
gtcgcctatgacttcaatgggaaagtaatgtatgcgctcgaagggagcattgctgttggc
ggatctagcgtgaaattcttagtgaacaacttcggcttcatcgacaaatccagtgacatc
agtgctctggcagagacagtcgaagatagtggtggtcttgtgtttgtaactgcttttagc
ggtttgttcgcaccatactggatggatgacgcacgcggcacgatgtttggaatcactacc
tacacacagcgtggacatgtggcccgcgcgacgcttgaggcaacatgtttccaaacaaag
gctatccttgacgccatggagaaggatagcggccaaaaattgacagaattagctgttgac
gggggcatgtgtaatagtgatttgactatgcagacccaatctgacatcatttccattccc
gtccaccggcccgcaatgcgagaaaccaccgctctcggtgctgcaattgcagcaggtctg
gcgattggcatctggcacggacttgaagaattagctaccgtgaataccgaaggccggact
gttttcacgccggccattcccaaggaacaggctacaagtcgattttcgaaatgggagaag
gctgtccaaatgtgcaaaggttgggctaattga

DBGET integrated database retrieval system