KEGG   Paracoccidioides brasiliensis: PAAG_06020Help
Entry
PAAG_06020        CDS       T02230                                 

Definition
dual specificity protein kinase FUZ7
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MGDSFKARTLKRKNVKGLALNAPAPKTGSNTSDGDAQVPGAIGNVESIRTDTLEIGLEFK
LDLRSEDLVVLKELGAGNGGTVSKVMHVSTKVVMARKVIRVDAKENVRKQIVRELQVGHD
CNSPYIVTFYGAFQNEARDIVLCMEYMDCGSLDRVSKDFGPVRVDVLGKIAESILGGLVY
LYEVHRIMHRDIKPSNVLLNSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGA
YSVRSDVWSVGLTIMELAVGRFPFDSTDSAAGDRASAGPMGILDLLQQIVHEPAPKLPKS
DAFPPILDDFVAKCLLKKPEERPTPRELYDKDAFLQAAKRTPVNLREWAISMMEQHNRKS
YLAPPAPKSINRDGSRDSMCHPRTAEPSPAPRFTPTSGEIPLNITREPLNSSGGLRVYSD
PMSAMEPSPTVGFEHLSLDGTSQYHPDHHDLHKALNNHNNPHHPNGNGSANPASARQQYT
KSYPSIDTSVPQHASPMSASATMTRAAIQSATLPSRVAPPPSGPLPAPPGSAGAAGWRSH
SHRV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactccttcaaagccagaacgctgaaacgaaagaacgtcaaggggctggctcta
aatgccccagcgccaaagaccggttcgaatacgtcggacggagatgctcaggtacccgga
gctattggcaatgtagagagcatccggacagacactctcgagatcgggttggagtttaag
cttgatctgaggagcgaggacttggtggttctgaaggagctgggtgctggcaatggaggc
accgtcagcaaggtcatgcatgtgtcgacgaaggttgttatggctagaaaggttatccgg
gtagacgcaaaagagaatgtgagaaagcagatagttcgggagctacaggtcggccatgat
tgcaattcgccatacattgtgacgttttatggtgcttttcagaacgaggccagggatatt
gtactttgcatggagtatatggattgtggctctctcgaccgagtctcaaaagacttcggc
ccagtccgtgtcgacgtcctcggaaaaatcgcagaatccatcctgggtggcctagtatac
ctctacgaagtccaccgcatcatgcatagagacatcaagccctccaacgtcctactgaac
tcacgaggaaatataaaactttgcgactttggcgtagctacggagaccgtcaactcgata
gcagacaccttcgttggcacgtcgacatacatggcccccgaacgtatccagggaggtgcc
tattccgtgcgttcagatgtgtggagcgtcggcttgaccatcatggaattggccgtggga
cgctttccctttgactcgacagattctgcagcgggtgaccgcgcaagcgcaggcccaatg
ggaattttggacctgctgcagcaaatcgtgcatgaaccggcaccaaagctgcccaagagc
gatgctttcccgcctattcttgatgactttgtggccaagtgcctgctcaagaagcctgaa
gagcgcccaactccccgcgagctctacgacaaggacgccttcctccaagccgccaaacga
acccccgtcaacctgcgcgaatgggcaatcagcatgatggaacagcacaaccgcaaatcc
taccttgccccgccagcgcccaaatccataaaccgcgacggctcacgagactccatgtgc
cacccgcgaaccgcagaaccctcccccgccccccgcttcacacccacctcaggcgaaata
ccgctaaacatcacccgcgaacccctgaacagcagcggcggactacgagtgtactcagat
cccatgtccgccatggagccctcgccaaccgtgggcttcgaacacctctcgctagacggc
acgagccagtaccacccggaccaccacgatctgcataaagcgctcaacaatcacaacaat
cctcatcaccccaacgggaacggctctgccaaccccgcctcggcacgccaacagtacacc
aagagctacccaagcatcgacacgtctgtgccgcagcatgcatcgcccatgtctgcgtct
gcaacgatgacgcgggctgctatacagtcagcgacgttgccgtcgagagtggccccgcca
ccctctggtccgctgcctgcgcctccgggctcagcgggcgcggcggggtggcggtcgcac
agtcatcgggtatga

DBGET integrated database retrieval system