KEGG   Paracoccidioides brasiliensis: PAAG_06020Help
Entry
PAAG_06020        CDS       T02230                                 

Definition
dual specificity protein kinase FUZ7
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAAG_06020
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PAAG_06020
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PAAG_06020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MGDSFKARTLKRKNVKGLALNAPAPKTGSNTSDGDAQVPGAIGNVESIRTDTLEIGLEFK
LDLRSEDLVVLKELGAGNGGTVSKVMHVSTKVVMARKVIRVDAKENVRKQIVRELQVGHD
CNSPYIVTFYGAFQNEARDIVLCMEYMDCGSLDRVSKDFGPVRVDVLGKIAESILGGLVY
LYEVHRIMHRDIKPSNVLLNSRGNIKLCDFGVATETVNSIADTFVGTSTYMAPERIQGGA
YSVRSDVWSVGLTIMELAVGRFPFDSTDSAAGDRASAGPMGILDLLQQIVHEPAPKLPKS
DAFPPILDDFVAKCLLKKPEERPTPRELYDKDAFLQAAKRTPVNLREWAISMMEQHNRKS
YLAPPAPKSINRDGSRDSMCHPRTAEPSPAPRFTPTSGEIPLNITREPLNSSGGLRVYSD
PMSAMEPSPTVGFEHLSLDGTSQYHPDHHDLHKALNNHNNPHHPNGNGSANPASARQQYT
KSYPSIDTSVPQHASPMSASATMTRAAIQSATLPSRVAPPPSGPLPAPPGSAGAAGWRSH
SHRV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgggtgactccttcaaagccagaacgctgaaacgaaagaacgtcaaggggctggctcta
aatgccccagcgccaaagaccggttcgaatacgtcggacggagatgctcaggtacccgga
gctattggcaatgtagagagcatccggacagacactctcgagatcgggttggagtttaag
cttgatctgaggagcgaggacttggtggttctgaaggagctgggtgctggcaatggaggc
accgtcagcaaggtcatgcatgtgtcgacgaaggttgttatggctagaaaggttatccgg
gtagacgcaaaagagaatgtgagaaagcagatagttcgggagctacaggtcggccatgat
tgcaattcgccatacattgtgacgttttatggtgcttttcagaacgaggccagggatatt
gtactttgcatggagtatatggattgtggctctctcgaccgagtctcaaaagacttcggc
ccagtccgtgtcgacgtcctcggaaaaatcgcagaatccatcctgggtggcctagtatac
ctctacgaagtccaccgcatcatgcatagagacatcaagccctccaacgtcctactgaac
tcacgaggaaatataaaactttgcgactttggcgtagctacggagaccgtcaactcgata
gcagacaccttcgttggcacgtcgacatacatggcccccgaacgtatccagggaggtgcc
tattccgtgcgttcagatgtgtggagcgtcggcttgaccatcatggaattggccgtggga
cgctttccctttgactcgacagattctgcagcgggtgaccgcgcaagcgcaggcccaatg
ggaattttggacctgctgcagcaaatcgtgcatgaaccggcaccaaagctgcccaagagc
gatgctttcccgcctattcttgatgactttgtggccaagtgcctgctcaagaagcctgaa
gagcgcccaactccccgcgagctctacgacaaggacgccttcctccaagccgccaaacga
acccccgtcaacctgcgcgaatgggcaatcagcatgatggaacagcacaaccgcaaatcc
taccttgccccgccagcgcccaaatccataaaccgcgacggctcacgagactccatgtgc
cacccgcgaaccgcagaaccctcccccgccccccgcttcacacccacctcaggcgaaata
ccgctaaacatcacccgcgaacccctgaacagcagcggcggactacgagtgtactcagat
cccatgtccgccatggagccctcgccaaccgtgggcttcgaacacctctcgctagacggc
acgagccagtaccacccggaccaccacgatctgcataaagcgctcaacaatcacaacaat
cctcatcaccccaacgggaacggctctgccaaccccgcctcggcacgccaacagtacacc
aagagctacccaagcatcgacacgtctgtgccgcagcatgcatcgcccatgtctgcgtct
gcaacgatgacgcgggctgctatacagtcagcgacgttgccgtcgagagtggccccgcca
ccctctggtccgctgcctgcgcctccgggctcagcgggcgcggcggggtggcggtcgcac
agtcatcgggtatga

DBGET integrated database retrieval system