KEGG   Paracoccidioides lutzii Pb01: PAAG_06057Help
Entry
PAAG_06057        CDS       T02230                                 

Definition
(RefSeq) hypothetical protein
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_06057
   00052 Galactose metabolism
    PAAG_06057
Enzymes [BR:pbl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PAAG_06057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 339 aa AA seqDB search
MASTSDQSAFTFLPLGGIIQEIRVAGQNIVLSFPTQEHYVRYNSSYFGATIGRTTNRLKD
SVIKNLNGQTYTLTTKQGPNSLHGGKEGWDSKLFEGPKAVLRNGKEALEFKYLSLDAEEG
YPGTVELRIWYTAGMEAAAESGGRAKTVLEIEYEVEFIGNECAETVVGVTNHTYFNLGDS
LTIEGTEAVLATDKYLPVDSTGIPLGTIENYTSTEVKKPFLLGATSPDFDHCFVVDTDAV
SIPVDTRFRPLRLNAAFKHLVTGINLEVQSTEPAFQFYTGEYINAPPIGDAPPRGPRSGF
CVEPSRYINAPNEPAWRSMSVLKQGQVWGSKIVYKVWKE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgacttcagaccaatctgctttcaccttccttcccctcggcgggattatccaa
gagatccgggttgctggccaaaacatcgtattgagtttcccgacgcaagagcactacgtc
aggtacaactcctcatactttggcgcaactattggtcgcactaccaaccggttgaaggat
tccgttattaagaatctcaatgggcaaacatacacgctaaccaccaaacaaggcccgaac
tcgctgcatggtgggaaagagggctgggattcaaagttgtttgagggccccaaggctgtg
cttaggaatgggaaggaagcgttggagttcaagtacttgagcttggatgccgaggagggc
tatccgggcaccgtggaactgagaatatggtatacagctggtatggaggcggcggctgag
agtggaggccgagccaaaacagttctagagattgaatatgaggtcgagtttatcggaaat
gagtgtgcagagactgtggtgggagtcacgaatcatacttactttaatctgggtgacagc
ctgacgatcgaaggtacagaggcagtactagccaccgacaaatacctgcctgtagattcc
acaggtattcccctgggcacgatagagaattacacctcaacggaagtcaagaagcctttc
ctcctcggtgccacgtccccagatttcgatcactgcttcgtcgtagacacggatgcggta
tcaattcccgttgacacccgttttcggccgctacgtctcaacgcagcattcaagcacctt
gtcaccggaataaatctcgaggtccaaagcacagagcccgcattccagttctacaccggt
gaatatatcaacgcccccccaattggtgacgccccaccacggggccctcgatctggattt
tgtgtggaacctagccgttatatcaacgcaccaaacgagcccgcatggaggagcatgagt
gtcttgaagcaggggcaagtttggggctccaagattgtgtacaaagtttggaaggagtag

DBGET integrated database retrieval system