KEGG   Paracoccidioides brasiliensis: PAAG_06084Help
Entry
PAAG_06084        CDS       T02230                                 

Definition
eukaryotic translation initiation factor 3 subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pbl  Paracoccidioides brasiliensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAAG_06084
Messenger RNA biogenesis [BR:pbl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     PAAG_06084
Translation factors [BR:pbl03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    PAAG_06084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 737 aa AA seqDB search
MAPSFDTLSEQDLHEEELEIDFSDLKAQYEVRLEESLDAFVVIDGLPIVPEESKPRLIKF
LLKKLNTVGRTSEDAIFMPMNEKQMTEGFAFVEYESPEQALEATKHLHGTPLDKKHTLAV
NKLTDIDRYGREGRVDEKYKPPTIEPFHEKDHLRSWLGDPNARDQFTMYRGDKVGVFWNM
KKDPPENIVDRDHWTQLFVQWSPQGTYLASVHPQGVQLWGGPQFTKQKQFPHPFVQLIEF
SPGESYLTTWSARPIQIEGPHPILSYEEDGKHFIIWDITTGKPLRSFVNHDVPAASGPEG
EAVKKKIQWPAFKWSADEKYVARMLPGQSISVYELPRMSLLDKASIKIEKVKDFEWAPAT
PQREGIKEYEQLLSFWTPEMDSNPAKVGLMSIPSKQIVRTRNLFHVTDVKLHWQSQGAYL
CVKVDRHSKSKKSLATNLEIFRVKEKGVPVEVVDSIKDPVINFAWEPNGDRFVLITTGEA
TPGAAIAPKTAVSFFCPEKVKVSGTGNFKLIRTIEKKTSNGIYWSPKGRFVVVATVHSQQ
NFDLDFWDLDFEGEKQENEKDLSANLQLMKTTDHYGVTDIDWDPTGRYVVSSASAWTHTL
ENGYNIHTFSGTTLAEHPTEKFKQFLWRPRPPTFLSKEEQKQIRKNLREYSREFDEEDKY
AVDIANTAIVEMRKRVLNEWTAWVRREKEMLDEEIDVLGLEREEDVAAAAKKEVETEGTV
VEEIMEEIIDETEEVIG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgagctttgacaccctttcagagcaggatctccacgaggaggagttggagatc
gacttttcagacctcaaagcgcaatatgaagtacgactggaagaaagcttggatgccttc
gttgttattgatggcctgccaattgtgccggaggagagcaaaccacgactcatcaagttc
ctgttgaaaaaattgaataccgttggccggacgagcgaagatgccatttttatgcccatg
aacgagaagcagatgaccgaaggattcgcatttgttgaatacgaatctccagaacaggcc
ctcgaggccactaaacatcttcacggcacccctcttgataagaaacatacattggctgtt
aataagctgacggatatcgatcggtatggacgtgagggccgtgttgatgagaaatataaa
ccacccaccatcgaaccatttcacgaaaaagatcatcttagatcctggctaggtgacccc
aatgcccgcgaccaatttaccatgtaccgaggggacaaagttggggtgttctggaacatg
aaaaaggacccaccagagaatatcgtagatagggatcattggacacagctttttgtgcag
tggtctccgcaggggacatacctcgcttccgttcatcctcaaggcgtacagctctgggga
ggcccgcaattcactaaacaaaagcaattcccccaccccttcgttcagctcatcgagttc
tcccccggtgaaagttacttgactacctggtcagcacgccccattcagatcgaaggaccg
cacccgatcctatcctacgaagaagacggcaagcattttattatttgggacatcactacg
ggcaagccattacgatcttttgtcaatcatgacgttccggctgcttctggcccggaggga
gaggctgtgaagaagaagatccaatggcctgcgtttaagtggtctgcagacgagaaatac
gtggcccggatgcttccaggtcaatctatatctgtttatgaactgccacggatgagtctc
ctcgacaaggcatctattaaaattgaaaaagttaaagatttcgagtgggcccccgccacc
cctcaacgtgaaggcatcaaggagtacgaacagctattatccttttggactcccgagatg
gacagtaacccagccaaagttggtttgatgagcattccttcgaagcaaattgtgcgaaca
agaaatctctttcatgttaccgatgttaaactgcactggcaatcgcagggtgcctatctc
tgtgtcaaagttgaccgacattccaaatctaagaagtccctcgccacaaacctcgaaatc
ttccgtgtcaaggagaagggagtgcctgttgaggttgtggattcaatcaaagatcccgtg
atcaacttcgcctgggaacccaatggtgatcgattcgttctgatcacaacaggtgaagct
actccaggtgctgcaatcgcgcccaaaaccgccgtctcattcttttgccctgagaaggtc
aaggtttccggcaccggcaacttcaaactcatccgcaccatcgagaagaagacgagcaac
ggcatatattggtctcccaaaggccggttcgttgttgttgccactgtccactcgcaacaa
aatttcgatctcgacttctgggacctagattttgagggcgagaagcaagagaacgagaag
gacctttctgccaatctccagctaatgaaaactaccgatcattacggcgtcaccgatatt
gactgggaccccactggccgctatgttgtcagcagtgccagcgcctggactcacactttg
gaaaacggctacaacatccatacattctccggcaccaccctggccgaacatcctaccgag
aagttcaagcaattcctctggcgcccacggcctccaacattcctcagcaaggaggagcaa
aagcaaatccgcaagaacctgcgcgaatactcccgcgagttcgacgaagaagacaaatac
gctgtcgatattgccaacacggccatcgtcgagatgcgtaagagagtcctcaacgaatgg
actgcttgggtgcgtcgggagaaggaaatgctggatgaggagattgatgtgctgggtcta
gagagggaggaggatgttgctgcggccgccaagaaagaggtagagacggagggcacagtt
gttgaggagattatggaggagatcattgatgaaacggaagaagttattggatga

DBGET integrated database retrieval system