KEGG   Paracoccidioides lutzii Pb01: PAAG_12154Help
Entry
PAAG_12154        CDS       T02230                                 

Gene name
PAAG_06098
Definition
(RefSeq) glycogen debranching enzyme
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1455 aa AA seqDB search
MSPPCASAPKRSQHEVYILPLTDDGAPDVAHGYVSLPHPTDPPYILRFVIEGSSAVCRQG
RLWVNIPHLGARFEREFFREYLLTPSFTHAIQIDIPITTPGAFAFYITYSPPPELPVATF
PSPRQIQAQDPAQVQLRSPTHYINVAPTISLNNQTLPLASVSVISLLSKFVGPNPSDWNK
HLLSIARRGYNMVHFTPIMARGESNSPYSIADHLAFDRCCFPSGESDVANMVSRMESQYG
LLPLTDVVWNHTANNTEWLQEHPEAGYNVETAPWLQAAVELDDTLLRYSEQLGQLGLPTQ
FDNVNDLLSVMNQMRANVIDKIRLWEFYAVDVQRDVEATIRAYQSGDVRIPEGGFGDHTI
GGLGEIKGWSLKEKAGFLRDRGLLNKDRLLGRYGRVVEPAVAAALLTALYGRYDAESSDI
PHIRSDLSKIFDEVNLPLFLEFDKDVLEIFDQLFNRIKYLRLDENGPKLGPVTKENPLIE
TYFTRLPLNEKTAKHNRNTLALVNNGWVWNADAMRDNAGPHSRAYLLRQVIIWGDCVKLR
YGSCRGDNPFLWDYMASYTKLMAKYFSAFRIDNCHSTPLAVAEYLLDEARRVRPNLAVFA
ELFTGSEEMDYLFTKRLGLNALIREAMQSWSTAELSRLVHRHGGRPIGSFDIDLPTDDFP
RENGINGGNNGNGKNCGARCETIKHVREIPVQALFMDCTHDNEMPAQKREARDTLPNAAL
VAMCASASGSVMGYDEIYPAHLDLVQETRRYSSVEPSEGRSADPSDKLSIVGEGGIGGAK
RLLNDLHTKMAVDGYDETHIHHDGEYITVHRVQPDTRRGVFLIAHTAFPGANGGALDPVC
LTGTKAKLIGAWRLEVDDSDKAKEAVLGDKEYLRGLPSQVISLDGVLISDKEDCTVISMP
QSFPSGSIVLLETWIPRAGLSQELSTFITTGAVEAFQKLDLIDLNFVLYRCNAEERDSSD
GKDGVYNVPNFRPLSSSRSTTFLHRLGPLLGRDVFISLRGLLLCTGRFDVAKDHIISFAS
VIKHGMIPNLLGSGKLPRYNSRDSVWFFLQAIQNYVTMVPDGIQLLEEKVPRRFLPYDDT
WFPFDDERAYSRSSTIEEIIQEVLQRHASGLSFREYNAGPQLDMQMKPEGFQVDIHVDWE
TGFMFGGNMWNCGTWMDKMGESEKAANKGYPGTPRDGAAIEITGLLYSALRWVSKLHEEG
RYMYAGVTTNSNETIKFSEWAQRIQSNFDRAYYIPVLSSHDAQHDIDPTIVHRRGIYKDL
YKSSSPYKDYQLRPNFAIAMTVAPDLFKLENAIHALVVADRVLRGPVGMATLDPGDLNYR
PYYNNAEDSEDFATSKGRNYHQGPEWVWPLGFFLRALLRFEIIRRRSLGKENKHEGAERD
VNGREEAFQLVASRLEGCKKMIAEGPWKGLTELTNKSGEFCADSAPTQAWSAACLLEVYY
DAAQHQKEDRPGDEG
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccccttgtgcttctgcgccgaaaaggagccagcacgaggtctacatcctccct
ctcaccgacgatggcgctccggacgtggcccacggatacgtttccttgccgcatcctaca
gatcccccatatatcctccgctttgtcattgaggggagcagcgctgtctgccgacaggga
aggttatgggttaatatccctcatcttggggcgcgatttgagagggagttttttagggaa
tatctactaacaccctcctttacgcacgcaattcaaatcgacataccaataaccacccct
ggcgcctttgccttttacataacctactctccacccccggagctaccagtagccactttc
ccatccccaagacagatacaggcgcaggacccagcccaagtccaactccgctccccaacc
cactacatcaatgtcgccccaacaatctctcttaacaaccaaacccttcctctagcctcc
gtctctgtaatctcactcctctccaaatttgtcggcccaaacccctcagactggaacaag
catctgctcagcatcgcccgtcgcggctacaacatggttcacttcacaccgatcatggcc
cgcggcgaatcgaactcgccatacagcatcgcggaccatctggcgtttgacagatgctgc
tttcccagtggcgagagcgacgttgctaatatggtgtcacgcatggagagtcagtatggt
ctcttaccacttacggatgttgtctggaatcacacggcgaataatacagagtggctacag
gagcacccagaggctgggtacaatgtggaaactgctccgtggttgcaggcggcggttgaa
ctggatgatacgctcttgcgctattcggaacagctgggccaactggggttacccacgcag
tttgacaatgtcaacgatttgctctcagtcatgaatcagatgagggccaatgtcattgat
aagattcgtctgtgggagttttatgctgttgatgttcagcgcgatgtggaagcgacgatt
cgggcgtatcagagcggtgatgtgaggattcccgagggcgggtttggtgaccatactatc
ggaggcttgggagagattaaggggtggagtttaaaggagaaggctgggttcttacgcgat
cggggtttacttaataaagatcggcttctggggcggtacggacgggtcgttgaacctgct
gtggctgcggcactgcttacagcactctatggccgttacgacgcagagtcttccgacatc
ccgcatattcgcagtgacctttctaagatcttcgacgaggttaatctcccactcttcctt
gagtttgataaagatgtcctagagatcttcgaccagctcttcaaccgcatcaagtatcta
cggctcgatgagaatgggccgaagttggggcctgttacgaaagaaaatcctctgatagaa
acctacttcacgcgcctgccactgaacgagaagacggcgaaacataaccggaatacgctt
gccctggttaataacgggtgggtatggaatgcggatgccatgcgtgacaacgctgggccg
cactcccgagcctatctactgcgccaggtcattatctggggagactgtgtcaaactccgt
tacggctcgtgtcggggcgacaacccgtttttgtgggactatatggccagctatacaaaa
ctgatggcgaaatacttctctgcctttcgcattgataattgccactccaccccgcttgct
gtggctgaatatcttctcgacgaggcgagaagggttcgtcccaatcttgctgtgtttgcg
gagttgttcacgggctcagaggagatggattatctctttacgaaacggcttgggcttaac
gcgctgattcgtgaggcgatgcagtcttggagtactgcggaacttagtcggctggtgcat
cgacatggtggtagacccataggcagttttgatattgatttgccgactgatgatttcccg
cgggagaatggtatcaatggcggtaacaatggcaatgggaagaattgtggggcaagatgt
gaaactatcaagcacgtccgcgaaatcccggtccaggcgctgtttatggactgtactcac
gataatgagatgcctgcacagaagagggaggcgagagataccctccctaatgccgcgctg
gtggcaatgtgtgcctccgcctccgggagtgtcatgggctatgatgagatatacccggcg
catctggatcttgtgcaagagacgcggcggtattcttccgtggaaccctctgagggaaga
agtgcggatccctctgacaagcttagtattgttggggaagggggtataggcggcgcgaag
aggttgctgaacgacctgcacacgaaaatggctgttgatggttatgatgagacccatatt
catcacgatggggagtatataactgtccatcgcgtgcagccagatacgagaaggggtgtt
ttcctcattgcccacacggcgttcccaggggcaaatggtggggcacttgaccctgtgtgt
cttacggggacgaaggcaaagctcatcggtgcgtggaggttggaagttgacgattcggat
aaggcgaaggaggctgttttgggggataaggaatacctgagaggtttacccagtcaggtt
attagtttggatggggttctaatttcggataaggaagattgtacggtgatttcgatgccg
cagtcattcccgtctggctctattgtgttgctggagacgtggattcctcgtgcgggttta
tcgcaggagttgagtacctttattacgacaggagcggtggaagcgtttcagaaacttgac
ctgatcgatcttaattttgtcctttacagatgcaatgcggaggagagggattctagtgac
ggtaaggatggcgtttacaatgtccccaattttcgtcccctctctagcagcaggtctacc
acatttctccaccgactgggcccgctgctgggtcgggatgtcttcatctctctccgcgga
cttctcctatgcaccggccgctttgatgtcgctaaagaccatattatctcctttgctagc
gtgattaagcacggcatgatccccaacctgcttggcagcggtaaactgccccgttacaac
tcgcgcgactctgtctggttcttcctccaggcaatacaaaactacgttactatggtcccc
gatgggatccagctgctggaggagaaggtgccccgccgctttcttccgtatgatgatacg
tggttccctttcgacgatgaaagggcgtatagccgttcctcaacgatagaggagattatc
caggaagtgctccagcgacatgcatctggtttgtcctttagggaatataatgctgggccg
cagttggacatgcagatgaaaccagaggggttccaagttgatatccatgtcgattgggag
actgggtttatgtttggaggtaacatgtggaactgcggtacgtggatggataagatgggc
gagagtgagaaggcagcgaacaaaggatacccgggcacaccgagggatggagcggcaatt
gagattacagggctgctatatagtgcactccgctgggtatcaaaactacacgaagaagga
cgttatatgtacgcaggcgtcacaactaactcaaacgaaaccatcaagttctccgagtgg
gcgcaacgtattcaatcaaacttcgatcgcgcctattacatccctgtcctctcctcccat
gacgcacaacatgacatcgacccaacaatcgtccatcgccggggaatatacaaggacctt
tacaaatcttccagcccatacaaggattaccaactccgccccaacttcgccatcgccatg
accgttgcaccagaccttttcaaattggagaatgctatccatgcgcttgttgttgcggat
agagtcctccggggcccagtggggatggccacgctggatccaggtgatttaaactatcga
ccgtactataataatgcggaggactctgaggattttgctacgtcaaaagggaggaattat
caccaaggtcccgagtgggtgtggcccctaggtttctttctgagggcattgttgaggttt
gagattattagaaggaggagcttggggaaagagaacaagcatgagggtgcagagagggat
gtgaatgggagggaagaggcgtttcagcttgtggcaagcaggttggaggggtgtaagaag
atgattgcggagggtccgtggaaagggctgacagagttgacgaacaagagtggagagttc
tgtgcggattcggccccgacccaggcgtggtcggcggcatgtttgctggaggtttattac
gatgcggcgcagcaccaaaaggaggacaggccgggggatgagggatga

DBGET integrated database retrieval system