KEGG   Paracoccidioides brasiliensis: PAAG_06098Help
Entry
PAAG_06098        CDS       T02230                                 

Definition
glycogen debranching enzyme
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pbl00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1492 aa AA seqDB search
MSPPCASAPKRSQHEVYILPLTDDGAPDVAHGYVSLPHPTDPPYILRFVIEGSSAVCRQG
RLWVNIPHLGARFEREFFREYLLTPSFTHAIQIDIPITTPGAFAFYITYSPPPELPVATF
PSPRQIQAQDPAQVQLRSPTHYINVAPTISLNNQTLPLASVSVISLLSKFVGPNPSDWNK
HLLSIARRGYNMVHFTPIMARGESNSPYSIADHLAFDRCCFPSGESDVANMVSRMESQYG
LLPLTDVVWNHTANNTEWLQEHPEAGYNVETAPWLQAAVELDDTLLRYSEQLGQLGLPTQ
FDNVNDLLSVMNQMRANVIDKIRLWEFYAVDVQRDVEATIRAYQSGDVRIPEGGFGDHTI
GGLGEIKGWSLKEKAGFLRDRGLLNKDRLLGRYGRVVEPAVAAALLTALYGRYDAESSDI
PHIRSDLSKIFDEVNLPLFLEFDKDVLEIFDQLFNRIKYLRLDENGPKLGPVTKENPLIE
TYFTRLPLNEKTAKHNRNTLALVNNGWVWNADAMRDNAGPHSRAYLLRQVIIWGDCVKLR
YGSCRGDNPFLWDYMASYTKLMAKYFSAFRIDNCHSTPLAVAEYLLDEARRVRPNLAVFA
ELFTGSEEMDYLFTKRLGLNALIREAMQSWSTAELSRLVHRHGGRPIGSFDIDLPTDDFP
RENGINGGNNGNGKNCGARCETIKHVREIPVQALFMDCTHDNEMPAQKREARDTLPNAAL
VAMCASASGSVMGYDEIYPAHLDLVQETRRYSSVEPSEGRSADPSDKLSIVGEGGIGGAK
RLLNDLHTKMAVDGYDETHIHHDGEYITVHRVQPDTRRGVFLIAHTAFPGANGGALDPVC
LTGTKAKLIGAWRLEVDDSDKAKEAVLGDKEYLRGLPSQVISLDGVLISDKEDCTVISMP
QSFPSGSIVLLETWIPRAGLSQELSTFITTGAVEAFQKLDLIDLNFVLYRCNAEERDSSD
GKDGVYNGWVGVCLETIVKHDGSWVILCVITFRTGQWALDFIVGRMERAIKLHGYERLQL
PTCMATKNVSIPLSSSRVYHISPPTGPAAGGRDVFISLRGLLLCTGRFDVAKDHIISFAS
VIKHGMIPNLLGSGKLPRYNSRDSVWFFLQAIQNYVTMVPDGIQLLEEKVPRRFLPYDDT
WFPFDDERAYSRSSTIEEIIQEVLQRHASGLSFREYNAGPQLDMQMKPEGFQVDIHVDWE
TGFMFGGNMWNCGTWMDKMGESEKAANKGYPGTPRDGAAIEITGLLYSALRWVSKLHEEG
RYMYAGVTTNSNETIKFSEWAQRIQSNFDRAYYIPVLSSHDAQHDIDPTIVHRRGIYKDL
YKSSSPYKDYQLRPNFAIAMTVAPDLFKLENAIHALVVADRVLRGPVGDGHAGSRNYHQG
PEWVWPLGFFLRALLRFEIIRRRSLGKENKHEGAERDVNGREEAFQLVASRLEGCKKMIA
EGPWKGLTELTNKSGEFCADSAPTQAWSAACLLEVYYDAAQHQKEDRPGDEG
NT seq 4479 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccccttgtgcttctgcgccgaaaaggagccagcacgaggtctacatcctccct
ctcaccgacgatggcgctccggacgtggcccacggatacgtttccttgccgcatcctaca
gatcccccatatatcctccgctttgtcattgaggggagcagcgctgtctgccgacaggga
aggttatgggttaatatccctcatcttggggcgcgatttgagagggagttttttagggaa
tatctactaacaccctcctttacgcacgcaattcaaatcgacataccaataaccacccct
ggcgcctttgccttttacataacctactctccacccccggagctaccagtagccactttc
ccatccccaagacagatacaggcgcaggacccagcccaagtccaactccgctccccaacc
cactacatcaatgtcgccccaacaatctctcttaacaaccaaacccttcctctagcctcc
gtctctgtaatctcactcctctccaaatttgtcggcccaaacccctcagactggaacaag
catctgctcagcatcgcccgtcgcggctacaacatggttcacttcacaccgatcatggcc
cgcggcgaatcgaactcgccatacagcatcgcggaccatctggcgtttgacagatgctgc
tttcccagtggcgagagcgacgttgctaatatggtgtcacgcatggagagtcagtatggt
ctcttaccacttacggatgttgtctggaatcacacggcgaataatacagagtggctacag
gagcacccagaggctgggtacaatgtggaaactgctccgtggttgcaggcggcggttgaa
ctggatgatacgctcttgcgctattcggaacagctgggccaactggggttacccacgcag
tttgacaatgtcaacgatttgctctcagtcatgaatcagatgagggccaatgtcattgat
aagattcgtctgtgggagttttatgctgttgatgttcagcgcgatgtggaagcgacgatt
cgggcgtatcagagcggtgatgtgaggattcccgagggcgggtttggtgaccatactatc
ggaggcttgggagagattaaggggtggagtttaaaggagaaggctgggttcttacgcgat
cggggtttacttaataaagatcggcttctggggcggtacggacgggtcgttgaacctgct
gtggctgcggcactgcttacagcactctatggccgttacgacgcagagtcttccgacatc
ccgcatattcgcagtgacctttctaagatcttcgacgaggttaatctcccactcttcctt
gagtttgataaagatgtcctagagatcttcgaccagctcttcaaccgcatcaagtatcta
cggctcgatgagaatgggccgaagttggggcctgttacgaaagaaaatcctctgatagaa
acctacttcacgcgcctgccactgaacgagaagacggcgaaacataaccggaatacgctt
gccctggttaataacgggtgggtatggaatgcggatgccatgcgtgacaacgctgggccg
cactcccgagcctatctactgcgccaggtcattatctggggagactgtgtcaaactccgt
tacggctcgtgtcggggcgacaacccgtttttgtgggactatatggccagctatacaaaa
ctgatggcgaaatacttctctgcctttcgcattgataattgccactccaccccgcttgct
gtggctgaatatcttctcgacgaggcgagaagggttcgtcccaatcttgctgtgtttgcg
gagttgttcacgggctcagaggagatggattatctctttacgaaacggcttgggcttaac
gcgctgattcgtgaggcgatgcagtcttggagtactgcggaacttagtcggctggtgcat
cgacatggtggtagacccataggcagttttgatattgatttgccgactgatgatttcccg
cgggagaatggtatcaatggcggtaacaatggcaatgggaagaattgtggggcaagatgt
gaaactatcaagcacgtccgcgaaatcccggtccaggcgctgtttatggactgtactcac
gataatgagatgcctgcacagaagagggaggcgagagataccctccctaatgccgcgctg
gtggcaatgtgtgcctccgcctccgggagtgtcatgggctatgatgagatatacccggcg
catctggatcttgtgcaagagacgcggcggtattcttccgtggaaccctctgagggaaga
agtgcggatccctctgacaagcttagtattgttggggaagggggtataggcggcgcgaag
aggttgctgaacgacctgcacacgaaaatggctgttgatggttatgatgagacccatatt
catcacgatggggagtatataactgtccatcgcgtgcagccagatacgagaaggggtgtt
ttcctcattgcccacacggcgttcccaggggcaaatggtggggcacttgaccctgtgtgt
cttacggggacgaaggcaaagctcatcggtgcgtggaggttggaagttgacgattcggat
aaggcgaaggaggctgttttgggggataaggaatacctgagaggtttacccagtcaggtt
attagtttggatggggttctaatttcggataaggaagattgtacggtgatttcgatgccg
cagtcattcccgtctggctctattgtgttgctggagacgtggattcctcgtgcgggttta
tcgcaggagttgagtacctttattacgacaggagcggtggaagcgtttcagaaacttgac
ctgatcgatcttaattttgtcctttacagatgcaatgcggaggagagggattctagtgac
ggtaaggatggcgtttacaatggctgggtgggagtgtgtttggaaactattgtcaaacat
gatggatcttgggtcatcctctgtgtgatcacctttcgaaccgggcaatgggcactagat
ttcattgttggacgaatggagagagcgatcaagttgcatggatatgagcgtctacagctt
ccaacctgcatggctacgaaaaacgtttcgattcccctctctagcagcagggtctaccac
atttctccaccgactgggcccgctgctgggggtcgggatgtcttcatctctctccgcgga
cttctcctatgcaccggccgctttgatgtcgctaaagaccatattatctcctttgctagc
gtgattaagcacggcatgatccccaacctgcttggcagcggtaaactgccccgttacaac
tcgcgcgactctgtctggttcttcctccaggcaatacaaaactacgttactatggtcccc
gatgggatccagctgctggaggagaaggtgccccgccgctttcttccgtatgatgatacg
tggttccctttcgacgatgaaagggcgtatagccgttcctcaacgatagaggagattatc
caggaagtgctccagcgacatgcatctggtttgtcctttagggaatataatgctgggccg
cagttggacatgcagatgaaaccagaggggttccaagttgatatccatgtcgattgggag
actgggtttatgtttggaggtaacatgtggaactgcggtacgtggatggataagatgggc
gagagtgagaaggcagcgaacaaaggatacccgggcacaccgagggatggagcggcaatt
gagattacagggctgctatatagtgcactccgctgggtatcaaaactacacgaagaagga
cgttatatgtacgcaggcgtcacaactaactcaaacgaaaccatcaagttctccgagtgg
gcgcaacgtattcaatcaaacttcgatcgcgcctattacatccctgtcctctcctcccat
gacgcacaacatgacatcgacccaacaatcgtccatcgccggggaatatacaaggacctt
tacaaatcttccagcccatacaaggattaccaactccgccccaacttcgccatcgccatg
accgttgcaccagaccttttcaaattggagaatgctatccatgcgcttgttgttgcggat
agagtcctccggggcccagtgggggatggccacgctggatccaggaattatcaccaaggt
cccgagtgggtgtggcccctaggtttctttctgagggcattgttgaggtttgagattatt
agaaggaggagcttggggaaagagaacaagcatgagggtgcagagagggatgtgaatggg
agggaagaggcgtttcagcttgtggcaagcaggttggaggggtgtaagaagatgattgcg
gagggtccgtggaaagggctgacagagttgacgaacaagagtggagagttctgtgcggat
tcggccccgacccaggcgtggtcggcggcatgtttgctggaggtttattacgatgcggcg
cagcaccaaaaggaggacaggccgggggatgagggatga

DBGET integrated database retrieval system