KEGG   Paracoccidioides lutzii Pb01: PAAG_12154Help
Entry
PAAG_12154        CDS       T02230                                 

Gene name
PAAG_06098
Definition
(RefSeq) glycogen debranching enzyme
  KO
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAAG_12154 (PAAG_06098)
Enzymes [BR:pbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PAAG_12154 (PAAG_06098)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     PAAG_12154 (PAAG_06098)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1455 aa AA seqDB search
MSPPCASAPKRSQHEVYILPLTDDGAPDVAHGYVSLPHPTDPPYILRFVIEGSSAVCRQG
RLWVNIPHLGARFEREFFREYLLTPSFTHAIQIDIPITTPGAFAFYITYSPPPELPVATF
PSPRQIQAQDPAQVQLRSPTHYINVAPTISLNNQTLPLASVSVISLLSKFVGPNPSDWNK
HLLSIARRGYNMVHFTPIMARGESNSPYSIADHLAFDRCCFPSGESDVANMVSRMESQYG
LLPLTDVVWNHTANNTEWLQEHPEAGYNVETAPWLQAAVELDDTLLRYSEQLGQLGLPTQ
FDNVNDLLSVMNQMRANVIDKIRLWEFYAVDVQRDVEATIRAYQSGDVRIPEGGFGDHTI
GGLGEIKGWSLKEKAGFLRDRGLLNKDRLLGRYGRVVEPAVAAALLTALYGRYDAESSDI
PHIRSDLSKIFDEVNLPLFLEFDKDVLEIFDQLFNRIKYLRLDENGPKLGPVTKENPLIE
TYFTRLPLNEKTAKHNRNTLALVNNGWVWNADAMRDNAGPHSRAYLLRQVIIWGDCVKLR
YGSCRGDNPFLWDYMASYTKLMAKYFSAFRIDNCHSTPLAVAEYLLDEARRVRPNLAVFA
ELFTGSEEMDYLFTKRLGLNALIREAMQSWSTAELSRLVHRHGGRPIGSFDIDLPTDDFP
RENGINGGNNGNGKNCGARCETIKHVREIPVQALFMDCTHDNEMPAQKREARDTLPNAAL
VAMCASASGSVMGYDEIYPAHLDLVQETRRYSSVEPSEGRSADPSDKLSIVGEGGIGGAK
RLLNDLHTKMAVDGYDETHIHHDGEYITVHRVQPDTRRGVFLIAHTAFPGANGGALDPVC
LTGTKAKLIGAWRLEVDDSDKAKEAVLGDKEYLRGLPSQVISLDGVLISDKEDCTVISMP
QSFPSGSIVLLETWIPRAGLSQELSTFITTGAVEAFQKLDLIDLNFVLYRCNAEERDSSD
GKDGVYNVPNFRPLSSSRSTTFLHRLGPLLGRDVFISLRGLLLCTGRFDVAKDHIISFAS
VIKHGMIPNLLGSGKLPRYNSRDSVWFFLQAIQNYVTMVPDGIQLLEEKVPRRFLPYDDT
WFPFDDERAYSRSSTIEEIIQEVLQRHASGLSFREYNAGPQLDMQMKPEGFQVDIHVDWE
TGFMFGGNMWNCGTWMDKMGESEKAANKGYPGTPRDGAAIEITGLLYSALRWVSKLHEEG
RYMYAGVTTNSNETIKFSEWAQRIQSNFDRAYYIPVLSSHDAQHDIDPTIVHRRGIYKDL
YKSSSPYKDYQLRPNFAIAMTVAPDLFKLENAIHALVVADRVLRGPVGMATLDPGDLNYR
PYYNNAEDSEDFATSKGRNYHQGPEWVWPLGFFLRALLRFEIIRRRSLGKENKHEGAERD
VNGREEAFQLVASRLEGCKKMIAEGPWKGLTELTNKSGEFCADSAPTQAWSAACLLEVYY
DAAQHQKEDRPGDEG
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccccttgtgcttctgcgccgaaaaggagccagcacgaggtctacatcctccct
ctcaccgacgatggcgctccggacgtggcccacggatacgtttccttgccgcatcctaca
gatcccccatatatcctccgctttgtcattgaggggagcagcgctgtctgccgacaggga
aggttatgggttaatatccctcatcttggggcgcgatttgagagggagttttttagggaa
tatctactaacaccctcctttacgcacgcaattcaaatcgacataccaataaccacccct
ggcgcctttgccttttacataacctactctccacccccggagctaccagtagccactttc
ccatccccaagacagatacaggcgcaggacccagcccaagtccaactccgctccccaacc
cactacatcaatgtcgccccaacaatctctcttaacaaccaaacccttcctctagcctcc
gtctctgtaatctcactcctctccaaatttgtcggcccaaacccctcagactggaacaag
catctgctcagcatcgcccgtcgcggctacaacatggttcacttcacaccgatcatggcc
cgcggcgaatcgaactcgccatacagcatcgcggaccatctggcgtttgacagatgctgc
tttcccagtggcgagagcgacgttgctaatatggtgtcacgcatggagagtcagtatggt
ctcttaccacttacggatgttgtctggaatcacacggcgaataatacagagtggctacag
gagcacccagaggctgggtacaatgtggaaactgctccgtggttgcaggcggcggttgaa
ctggatgatacgctcttgcgctattcggaacagctgggccaactggggttacccacgcag
tttgacaatgtcaacgatttgctctcagtcatgaatcagatgagggccaatgtcattgat
aagattcgtctgtgggagttttatgctgttgatgttcagcgcgatgtggaagcgacgatt
cgggcgtatcagagcggtgatgtgaggattcccgagggcgggtttggtgaccatactatc
ggaggcttgggagagattaaggggtggagtttaaaggagaaggctgggttcttacgcgat
cggggtttacttaataaagatcggcttctggggcggtacggacgggtcgttgaacctgct
gtggctgcggcactgcttacagcactctatggccgttacgacgcagagtcttccgacatc
ccgcatattcgcagtgacctttctaagatcttcgacgaggttaatctcccactcttcctt
gagtttgataaagatgtcctagagatcttcgaccagctcttcaaccgcatcaagtatcta
cggctcgatgagaatgggccgaagttggggcctgttacgaaagaaaatcctctgatagaa
acctacttcacgcgcctgccactgaacgagaagacggcgaaacataaccggaatacgctt
gccctggttaataacgggtgggtatggaatgcggatgccatgcgtgacaacgctgggccg
cactcccgagcctatctactgcgccaggtcattatctggggagactgtgtcaaactccgt
tacggctcgtgtcggggcgacaacccgtttttgtgggactatatggccagctatacaaaa
ctgatggcgaaatacttctctgcctttcgcattgataattgccactccaccccgcttgct
gtggctgaatatcttctcgacgaggcgagaagggttcgtcccaatcttgctgtgtttgcg
gagttgttcacgggctcagaggagatggattatctctttacgaaacggcttgggcttaac
gcgctgattcgtgaggcgatgcagtcttggagtactgcggaacttagtcggctggtgcat
cgacatggtggtagacccataggcagttttgatattgatttgccgactgatgatttcccg
cgggagaatggtatcaatggcggtaacaatggcaatgggaagaattgtggggcaagatgt
gaaactatcaagcacgtccgcgaaatcccggtccaggcgctgtttatggactgtactcac
gataatgagatgcctgcacagaagagggaggcgagagataccctccctaatgccgcgctg
gtggcaatgtgtgcctccgcctccgggagtgtcatgggctatgatgagatatacccggcg
catctggatcttgtgcaagagacgcggcggtattcttccgtggaaccctctgagggaaga
agtgcggatccctctgacaagcttagtattgttggggaagggggtataggcggcgcgaag
aggttgctgaacgacctgcacacgaaaatggctgttgatggttatgatgagacccatatt
catcacgatggggagtatataactgtccatcgcgtgcagccagatacgagaaggggtgtt
ttcctcattgcccacacggcgttcccaggggcaaatggtggggcacttgaccctgtgtgt
cttacggggacgaaggcaaagctcatcggtgcgtggaggttggaagttgacgattcggat
aaggcgaaggaggctgttttgggggataaggaatacctgagaggtttacccagtcaggtt
attagtttggatggggttctaatttcggataaggaagattgtacggtgatttcgatgccg
cagtcattcccgtctggctctattgtgttgctggagacgtggattcctcgtgcgggttta
tcgcaggagttgagtacctttattacgacaggagcggtggaagcgtttcagaaacttgac
ctgatcgatcttaattttgtcctttacagatgcaatgcggaggagagggattctagtgac
ggtaaggatggcgtttacaatgtccccaattttcgtcccctctctagcagcaggtctacc
acatttctccaccgactgggcccgctgctgggtcgggatgtcttcatctctctccgcgga
cttctcctatgcaccggccgctttgatgtcgctaaagaccatattatctcctttgctagc
gtgattaagcacggcatgatccccaacctgcttggcagcggtaaactgccccgttacaac
tcgcgcgactctgtctggttcttcctccaggcaatacaaaactacgttactatggtcccc
gatgggatccagctgctggaggagaaggtgccccgccgctttcttccgtatgatgatacg
tggttccctttcgacgatgaaagggcgtatagccgttcctcaacgatagaggagattatc
caggaagtgctccagcgacatgcatctggtttgtcctttagggaatataatgctgggccg
cagttggacatgcagatgaaaccagaggggttccaagttgatatccatgtcgattgggag
actgggtttatgtttggaggtaacatgtggaactgcggtacgtggatggataagatgggc
gagagtgagaaggcagcgaacaaaggatacccgggcacaccgagggatggagcggcaatt
gagattacagggctgctatatagtgcactccgctgggtatcaaaactacacgaagaagga
cgttatatgtacgcaggcgtcacaactaactcaaacgaaaccatcaagttctccgagtgg
gcgcaacgtattcaatcaaacttcgatcgcgcctattacatccctgtcctctcctcccat
gacgcacaacatgacatcgacccaacaatcgtccatcgccggggaatatacaaggacctt
tacaaatcttccagcccatacaaggattaccaactccgccccaacttcgccatcgccatg
accgttgcaccagaccttttcaaattggagaatgctatccatgcgcttgttgttgcggat
agagtcctccggggcccagtggggatggccacgctggatccaggtgatttaaactatcga
ccgtactataataatgcggaggactctgaggattttgctacgtcaaaagggaggaattat
caccaaggtcccgagtgggtgtggcccctaggtttctttctgagggcattgttgaggttt
gagattattagaaggaggagcttggggaaagagaacaagcatgagggtgcagagagggat
gtgaatgggagggaagaggcgtttcagcttgtggcaagcaggttggaggggtgtaagaag
atgattgcggagggtccgtggaaagggctgacagagttgacgaacaagagtggagagttc
tgtgcggattcggccccgacccaggcgtggtcggcggcatgtttgctggaggtttattac
gatgcggcgcagcaccaaaaggaggacaggccgggggatgagggatga

DBGET integrated database retrieval system