KEGG   Paracoccidioides lutzii Pb01: PAAG_06268Help
Entry
PAAG_06268        CDS       T02230                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  
cytochrome c
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAAG_06268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 156 aa AA seqDB search
MSLEMTMACMVYAMLEQEELNEENERKRKLKELVRLHPELKRPTTNFTPLLNPGDAAKGA
GLFKTRCAQCHTLEAGGANKVGPNLHGLFGRKSGTVEGYSYTDANKQRGVEWNEQSLFEY
LENPKKYIPGTKMAFGGLKKPKDRNDLITYLQNETK
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggagatgacgatggcgtgcatggtgtacgcgatgctcgagcaggaggagcta
aacgaagaaaacgaacgcaagagaaagctgaaggaactcgttcgactgcatccggagctt
aagaggccgactactaattttacccctcttctcaatccaggtgacgctgctaagggtgct
ggtctcttcaagactcgctgcgctcagtgccacaccctcgaggctggcggtgctaacaag
gtcggccccaacttgcacggacttttcggccgcaagagtggtactgtcgaagggtactcc
tacaccgacgcaaacaagcagagaggtgtcgagtggaacgaacagtctttgtttgaatac
cttgagaacccaaagaagtacatccctggcaccaagatggctttcggtggcctcaagaag
cccaaggaccgcaacgatctgatcacctacctccaaaacgaaaccaaataa

DBGET integrated database retrieval system