KEGG   Paracoccidioides brasiliensis: PAAG_06268Help
Entry
PAAG_06268        CDS       T02230                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAAG_06268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 111 aa AA seqDB search
MGKDSFSPGDAAKGAGLFKTRCAQCHTLEAGGANKVGPNLHGLFGRKSGTVEGYSYTDAN
KQRGVEWNEQSLFEYLENPKKYIPGTKMAFGGLKKPKDRNDLITYLQNETK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaagacagcttctctcctggtgacgctgctaagggtgctggtctcttcaagact
cgctgcgctcagtgccacaccctcgaggctggcggtgctaacaaggtcggccccaacttg
cacggacttttcggccgcaagagtggtactgtcgaagggtactcctacaccgacgcaaac
aagcagagaggtgtcgagtggaacgaacagtctttgtttgaataccttgagaacccaaag
aagtacatccctggcaccaagatggctttcggtggcctcaagaagcccaaggaccgcaac
gatctgatcacctacctccaaaacgaaaccaaataa

DBGET integrated database retrieval system