KEGG   Paracoccidioides lutzii Pb01: PAAG_06289Help
Entry
PAAG_06289        CDS       T02230                                 

Definition
(RefSeq) tryptophan synthase
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAAG_06289
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAAG_06289
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAAG_06289
Enzymes [BR:pbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAAG_06289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 724 aa AA seqDB search
MEKIKETFARCRQEKRCALVAYVTAGYPEKDDTPDIALAMEAGGADVIELGIPFTDPIAD
GPTIQRANTQALKNGVTVTSVLEMVRIARRRGLKIPVLLMGYYNPLLQYKEEKMLKDAKV
AGVNGFIMVDLPPEEAVRFRDLCRKEGLSYVPLIAPATSDSRMKLLCKIADSFIYVVSRM
GVTGATGKLSEGLPELLARVHAYSGNIPTALGFGISTREHFLKVQDISEGAVIGSQMITV
LGEAPAGQRAQKIEEYCTSITGRKVERSTESKSLTREVGLSEMLSQAQQPTNAQVDHVIT
NGQPDSEVGLVEQQLALNVTRDQAAMPARFGEFGGQYVPESLMDSLAELEAGFKKAKDDP
TFWEEFRSYYPYMSRPSSLHLAERLTEYAGGANIYLKREDLNHTGSHKINNALGQVLLAR
RLGKTRIIAETGAGQHGVATATVCAKFGMDCVIYMGAEDVRRQALNVFRIKLLGAKVVAV
EAGSRTLRDAVNEALRAWVVHLDTTHYVIGSAIGPHPFPTIVRTLQSVIGEETKEQMLKL
TGRLPDAVVACVGGGSNAVGMFYPFSNELSVKLLGVEAGGDGTDTTRHSATLSHGSKGVL
HGVRTYILQDEHGQISDTYSISAGLDYPGVGPELSSWKDQSRATFIAATDAQALQGFRLI
TELEGIIPALESSHAVYGAVELAKTMKKGENVVLNLSGRGDKDVQSVAEALPELGPKIGW
DLRF
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggagaagataaaagagacgtttgcacgatgcaggcaggaaaagcgctgtgcgctggtc
gcatatgtgacagctggttaccctgagaaggatgatacgcctgacatagcacttgcaatg
gaagctggcggagctgatgtgattgaacttggcatccctttcacagatcctatcgccgac
ggtcctaccatccaaagagctaatacacaagcgttgaagaacggtgttacggtcacctcg
gtgcttgagatggtgcggattgcgaggagaagaggactgaaaattcccgtgctgctcatg
ggatactacaatccattgctccagtataaagaggagaaaatgttgaaagacgcgaaagtg
gcaggtgtgaatggattcatcatggttgatcttccaccagaagaagcggtgcggtttcgg
gatttgtgcagaaaggaggggttatcctatgttccactgatcgcacccgccacttccgat
tctcgaatgaaattgctctgcaagatcgctgattcctttatctacgtcgtctctcgaatg
ggtgttacaggtgcaactggcaaactcagcgaagggcttccggagctccttgctcgggtc
catgcctactctggaaacattcccactgcgctaggattcggcatcagcacgagagagcat
ttcttgaaggtgcaggatatctctgagggtgcagtcatcggcagccagatgatcactgtt
ctcggtgaagctcctgctggccagagagcccagaaaatcgaagaatattgcacgagcatc
actgggaggaaagtggaacgtagcacagaatccaaatctttaactcgagaagtgggcctt
tctgaaatgctctctcaagctcaacagccaacaaatgcgcaggttgatcatgtcattacg
aatggccagcctgattctgaagtcggcctggtcgagcaacagctcgctctcaatgtgacc
agagatcaggccgcaatgcctgctcgcttcggcgagtttggcggccagtacgtgccagag
tctctcatggacagcctcgctgagcttgaggcaggattcaagaaggctaaagatgacccc
acattctgggaagagtttcggtcgtattatccttatatgagccgaccaagcagtctgcat
cttgcagagcgcctgaccgaatatgccggaggagctaacatctatctcaagcgcgaagac
ctaaatcacacaggaagccacaagatcaacaatgcgctcggccaagttttgctggctcgt
cgccttggcaaaacgcgtattatcgcagagaccggggcgggccagcatggtgtagcgact
gctactgtctgcgcaaagtttggcatggattgcgtcatctacatgggcgctgaagatgtg
cgtcgccaagcccttaacgtattccgcatcaaactcctcggagccaaagtcgtcgccgtc
gaagccggttcgcgtacacttcgtgatgccgtcaacgaagcgctacgagcctgggttgtc
catctcgataccacacactacgtgattggttctgccattggaccccatcctttccccact
atcgtccgaacactccaatccgtcatcggcgaagaaaccaaagaacaaatgctaaagcta
actggcagattacccgatgctgttgtcgcctgtgtaggtggcggtagcaacgcggtcggc
atgttctaccccttctccaatgaactcagcgtcaagctcctcggcgtcgaagccggtggc
gatggcacagacaccacccgacactccgcaacgctttcgcacggctctaagggtgtcctg
cacggtgtgcgtacctacatcctgcaagacgaacatggccagatttccgacacctactcc
atatctgcagggcttgactatcccggagttggaccggagctttcgtcgtggaaggaccag
tcccgtgccacgttcattgccgcaacggatgcgcaagcgcttcagggtttccggctgatt
actgagttggaggggatcattcccgcgctcgagtcgtctcatgcggtgtatggagctgtg
gaattggcgaagacgatgaagaaaggggagaatgttgtgctgaatttaagtggaaggggt
gataaagatgtgcagagtgtggcggaagcattgccggagttgggccctaagattggctgg
gatttgaggttttga

DBGET integrated database retrieval system