KEGG   Paracoccidioides brasiliensis: PAAG_06289Help
Entry
PAAG_06289        CDS       T02230                                 

Definition
tryptophan synthase
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAAG_06289
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAAG_06289
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAAG_06289
Enzymes [BR:pbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAAG_06289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 724 aa AA seqDB search
MEKIKETFARCRQEKRCALVAYVTAGYPEKDDTPDIALAMEAGGADVIELGIPFTDPIAD
GPTIQRANTQALKNGVTVTSVLEMVRIARRRGLKIPVLLMGYYNPLLQYKEEKMLKDAKV
AGVNGFIMVDLPPEEAVRFRDLCRKEGLSYVPLIAPATSDSRMKLLCKIADSFIYVVSRM
GVTGATGKLSEGLPELLARVHAYSGNIPTALGFGISTREHFLKVQDISEGAVIGSQMITV
LGEAPAGQRAQKIEEYCTSITGRKVERSTESKSLTREVGLSEMLSQAQQPTNAQVDHVIT
NGQPDSEVGLVEQQLALNVTRDQAAMPARFGEFGGQYVPESLMDSLAELEAGFKKAKDDP
TFWEEFRSYYPYMSRPSSLHLAERLTEYAGGANIYLKREDLNHTGSHKINNALGQVLLAR
RLGKTRIIAETGAGQHGVATATVCAKFGMDCVIYMGAEDVRRQALNVFRIKLLGAKVVAV
EAGSRTLRDAVNEALRAWVVHLDTTHYVIGSAIGPHPFPTIVRTLQSVIGEETKEQMLKL
TGRLPDAVVACVGGGSNAVGMFYPFSNELSVKLLGVEAGGDGTDTTRHSATLSHGSKGVL
HGVRTYILQDEHGQISDTYSISAGLDYPGVGPELSSWKDQSRATFIAATDAQALQGFRLI
TELEGIIPALESSHAVYGAVELAKTMKKGENVVLNLSGRGDKDVQSVAEALPELGPKIGW
DLRF
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggagaagataaaagagacgtttgcacgatgcaggcaggaaaagcgctgtgcgctggtc
gcatatgtgacagctggttaccctgagaaggatgatacgcctgacatagcacttgcaatg
gaagctggcggagctgatgtgattgaacttggcatccctttcacagatcctatcgccgac
ggtcctaccatccaaagagctaatacacaagcgttgaagaacggtgttacggtcacctcg
gtgcttgagatggtgcggattgcgaggagaagaggactgaaaattcccgtgctgctcatg
ggatactacaatccattgctccagtataaagaggagaaaatgttgaaagacgcgaaagtg
gcaggtgtgaatggattcatcatggttgatcttccaccagaagaagcggtgcggtttcgg
gatttgtgcagaaaggaggggttatcctatgttccactgatcgcacccgccacttccgat
tctcgaatgaaattgctctgcaagatcgctgattcctttatctacgtcgtctctcgaatg
ggtgttacaggtgcaactggcaaactcagcgaagggcttccggagctccttgctcgggtc
catgcctactctggaaacattcccactgcgctaggattcggcatcagcacgagagagcat
ttcttgaaggtgcaggatatctctgagggtgcagtcatcggcagccagatgatcactgtt
ctcggtgaagctcctgctggccagagagcccagaaaatcgaagaatattgcacgagcatc
actgggaggaaagtggaacgtagcacagaatccaaatctttaactcgagaagtgggcctt
tctgaaatgctctctcaagctcaacagccaacaaatgcgcaggttgatcatgtcattacg
aatggccagcctgattctgaagtcggcctggtcgagcaacagctcgctctcaatgtgacc
agagatcaggccgcaatgcctgctcgcttcggcgagtttggcggccagtacgtgccagag
tctctcatggacagcctcgctgagcttgaggcaggattcaagaaggctaaagatgacccc
acattctgggaagagtttcggtcgtattatccttatatgagccgaccaagcagtctgcat
cttgcagagcgcctgaccgaatatgccggaggagctaacatctatctcaagcgcgaagac
ctaaatcacacaggaagccacaagatcaacaatgcgctcggccaagttttgctggctcgt
cgccttggcaaaacgcgtattatcgcagagaccggggcgggccagcatggtgtagcgact
gctactgtctgcgcaaagtttggcatggattgcgtcatctacatgggcgctgaagatgtg
cgtcgccaagcccttaacgtattccgcatcaaactcctcggagccaaagtcgtcgccgtc
gaagccggttcgcgtacacttcgtgatgccgtcaacgaagcgctacgagcctgggttgtc
catctcgataccacacactacgtgattggttctgccattggaccccatcctttccccact
atcgtccgaacactccaatccgtcatcggcgaagaaaccaaagaacaaatgctaaagcta
actggcagattacccgatgctgttgtcgcctgtgtaggtggcggtagcaacgcggtcggc
atgttctaccccttctccaatgaactcagcgtcaagctcctcggcgtcgaagccggtggc
gatggcacagacaccacccgacactccgcaacgctttcgcacggctctaagggtgtcctg
cacggtgtgcgtacctacatcctgcaagacgaacatggccagatttccgacacctactcc
atatctgcagggcttgactatcccggagttggaccggagctttcgtcgtggaaggaccag
tcccgtgccacgttcattgccgcaacggatgcgcaagcgcttcagggtttccggctgatt
actgagttggaggggatcattcccgcgctcgagtcgtctcatgcggtgtatggagctgtg
gaattggcgaagacgatgaagaaaggggagaatgttgtgctgaatttaagtggaaggggt
gataaagatgtgcagagtgtggcggaagcattgccggagttgggccctaagattggctgg
gatttgaggttttga

DBGET integrated database retrieval system