KEGG   Paracoccidioides lutzii Pb01: PAAG_06309Help
Entry
PAAG_06309        CDS       T02230                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00062  Fatty acid elongation
pbl00071  Fatty acid degradation
pbl00280  Valine, leucine and isoleucine degradation
pbl00310  Lysine degradation
pbl00380  Tryptophan metabolism
pbl00410  beta-Alanine metabolism
pbl00640  Propanoate metabolism
pbl00650  Butanoate metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01130  Biosynthesis of antibiotics
pbl01200  Carbon metabolism
pbl01212  Fatty acid metabolism
Module
pbl_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAAG_06309
   00650 Butanoate metabolism
    PAAG_06309
  Lipid metabolism
   00062 Fatty acid elongation
    PAAG_06309
   00071 Fatty acid degradation
    PAAG_06309
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAAG_06309
   00310 Lysine degradation
    PAAG_06309
   00380 Tryptophan metabolism
    PAAG_06309
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAAG_06309
Enzymes [BR:pbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAAG_06309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 9094961
NCBI-ProteinID: XP_015700079
UniProt: C1H6B8
Position
Unknown
AA seq 293 aa AA seqDB search
MFARRCERLVTRTAAAALASYVRSSRLYSIASPAYEYILTSTPKPGVGLITLNRPKALNA
LCSPLFRELNHAFTKFDEDKDIGAIVLTGSEKAFAAGADIKEMAPLTFASAYSNNFIATW
SHLANTIRTPVIAAVSGYALGGGCELAMMCDIIYCTSNATFGQPEIKLGTIPGAGGSQRL
TRAIGKSRAMELILTGRNFSGKEAGEWGLAAKVTDGGKDELVAAAVETASTIASYSRVAV
VAAKEVVNKSQELSLKEGVEFERRLFHGLFGSKDQKIGMTAFAEKKKPEWSNE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctagacgatgtgagaggcttgttacccgcaccgcggcagccgcccttgcttca
tatgtgagaagcagcagactatattccatcgcttcaccagcttatgagtatatcctcacc
tcaacaccaaaaccgggtgttggcctcatcactcttaacagaccaaaggctctcaatgca
ctttgcagtccccttttccgcgaactaaaccatgcctttaccaagttcgatgaggataag
gatattggtgctatagtccttacgggcagtgaaaaggcctttgccgctggcgcggatatc
aaggaaatggcacctctcacttttgcatctgcatattcaaacaactttatcgccacctgg
tcgcaccttgcgaataccattcgtacccctgtcatcgctgccgtgtctgggtatgcccta
ggcggcggatgtgaacttgcaatgatgtgcgatataatctactgcacatctaacgcaact
tttggccagccagaaatcaaacttggaaccattcccggtgctggaggttcccaacgtctc
acgagagcaattgggaagagcagagctatggaactcatccttaccggcaggaacttcagt
ggaaaagaggcaggtgagtggggcctagctgcgaaagtcactgatggaggcaaggatgag
ctagttgcggccgcagtcgagacggctagtaccattgccagctacagtcgcgtcgcagtc
gttgctgcgaaggaggttgtcaacaagagccaggagttgtccttgaaggaaggagttgaa
tttgagagacggttattccatggattatttggcagtaaagatcagaaaattggaatgact
gctttcgctgaaaaaaagaagcctgaatggtcgaacgaatag

DBGET integrated database retrieval system