KEGG   Paracoccidioides brasiliensis: PAAG_06332Help
Entry
PAAG_06332        CDS       T02230                                 

Definition
RNA polymerase II transcription factor B subunit 2
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    PAAG_06332
  Replication and repair
   03420 Nucleotide excision repair
    PAAG_06332
Transcription machinery [BR:pbl03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     PAAG_06332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MAVSSSRSMDYLESLPGTVFRRLYQQPSTALAIFRRMLPYLAKYFVMALLYLKDPLPAAD
LELWVKPESKRERDNALSILGRLHILSNATTTDHVRAYVVTEPFASSLRQALTGGDKQQS
FGVPSVTPDANLMTVAQLDEYASRQWEGVLGYMVGTSALGAQQTVTLSKGVKQLLQACHL
VEVHDRRVDITKEGFAFVLQDVNTQVWNILILYVENAEQIGLESVEVLSFLFVLSSLELG
QSYEKKHLTSTQLKTLTDLTDFGIVYQHFPPQEATRFYPTRLVTTLTSDSATLGSSISTS
LTGPSGPTAANSSEPSTGFIVIETNYRLYAYTSSPLQISLIALFTTLKYRFPNLITGKIT
RQSIRRAVEMGITADQIISYLTTHAHPQMRKYHASKSSHTVGAPAVLPPTVVDQIRLWQL
ERDRIKATPGFLFKDFVSLAEFDGPCRYAEEIGVLVWKSEKRRMFFVTRHEQVAAYLRSR
AGKS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtcgtcttcccgctcgatggactatctggagagtttgccaggaaccgtcttc
cgcagactgtaccagcagccatccacggctctagctatcttccggcgaatgttgccgtac
ctggcgaaatatttcgtcatggcacttctctacctgaaggatccacttcctgctgcggat
cttgaactatgggtgaagccggagagcaaacgtgagagagataatgcactgtcgatattg
ggtcgactccatattctctcaaatgccactaccacggatcatgttagagcatacgtggta
acggagccgttcgcgtcgtcgcttcgacaagccctcacaggaggagataagcagcaatct
ttcggagtaccatctgtaactccggatgcaaatcttatgactgttgctcagctggacgaa
tatgccagtcgccagtgggaaggcgttttagggtacatggttgggacgagcgccttagga
gcccagcaaacagtcacattaagcaagggtgtgaaacagctccttcaagcctgccatctg
gtggaagtccatgaccgtagagtcgatattacaaaagaaggcttcgccttcgtcctacaa
gacgtcaacacccaagtttggaacatcttaatcctctacgtcgaaaacgccgaacagata
ggcttagaaagtgtcgaggtcctctcattcctcttcgtcctcagcagcctagagctcggg
cagtcgtatgagaagaaacacttaacatccactcaactcaagactctcaccgacctcacc
gatttcggaatagtatatcaacacttccccccacaagaagcaacccgtttctaccccacc
aggctcgtaacaactcttacttctgactccgctacactcggaagctccatctccaccagt
ctcacaggtccaagcggccccactgccgcgaactccagcgaacccagcactggcttcata
gtcatcgaaaccaactaccgcctatatgcctacacatcttcccccctacaaatttctcta
atcgccttattcaccactctaaaataccgcttccccaacctcatcacaggaaaaataaca
cgccaatccatacgacgcgccgtcgaaatgggaatcactgcagaccagataatctcttac
ctaactacccacgcccatccgcaaatgcgcaaataccacgcatcgaaatcctcccatacc
gttggcgctcccgccgtgctcccgcccacagttgtagaccagatccgcctgtggcaattg
gagcgggatcgaataaaggcgacgccaggtttcctttttaaagactttgtcagtctggca
gagttcgatgggccgtgtaggtatgcagaggagattggggtgttggtgtggaagtctgag
aagcggcgaatgttttttgtcacgaggcatgagcaagttgcggcgtatttgaggagcagg
gctgggaagagctaa

DBGET integrated database retrieval system