KEGG   Paracoccidioides brasiliensis: PAAG_06460Help
Entry
PAAG_06460        CDS       T02230                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_06460
   01230 Biosynthesis of amino acids
    PAAG_06460
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAAG_06460
   00051 Fructose and mannose metabolism
    PAAG_06460
   00562 Inositol phosphate metabolism
    PAAG_06460
Enzymes [BR:pbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAAG_06460
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAAG_06460
  Exosomal proteins of bladder cancer cells
   PAAG_06460
  Exosomal proteins of melanoma cells
   PAAG_06460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 229 aa AA seqDB search
MAPPEYPLLPKTLLVISLKTYFTPSRTITYLRSLIDPQNEILRPDNRSQLLLALIPDFLT
IYPCSEILQSHFPELQTTEQQYQQQQNNQRQPPPFLLGAQDCFWKPLGPYTGEISPSCLK
DLNVSLVELGHAERRDIFHETDEQVGRKAAAVSVHGMIPLVCVGEVSWPGSIMADAVRTA
VVECAVQVRAVLESVPSYAPVVFAYEPVWAIGKASAGWCGARGWCGGGD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcctgaataccccctcctcccaaaaacccttctcgtaatctctctaaaaacg
tacttcaccccatcccgcacaattacctacctccgcagcctcatagatccccaaaacgaa
attctccgccccgataaccgctcacagctcctcctcgctctaatcccagacttcctaaca
atctacccctgctctgaaatcctccaatcacacttcccagaactccaaacaaccgagcag
caatatcaacagcaacaaaacaatcaacgacagccacctcctttcctcctcggggcccaa
gattgcttctggaaacccctgggcccctatactggtgaaatctccccctcatgcctcaaa
gacctaaacgtctccctggtcgaactcggccacgccgaacggcgcgacatcttccacgaa
accgatgagcaagttggtcgcaaggcagccgccgtgagcgttcatggcatgatccctctc
gtctgcgtgggtgaagtctcgtggcccgggtcaattatggctgacgcagtgcgaacggca
gttgttgagtgtgcggtgcaggttagagcagtgcttgagtctgtgcctagctatgcccct
gtggtctttgcttacgagcctgtctgggcaattggaaaagccagtgccggctggtgtgga
gcacgtggctggtgtggtggaggggattag

DBGET integrated database retrieval system