KEGG   Paracoccidioides brasiliensis: PAAG_06464Help
Entry
PAAG_06464        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PAAG_06464
Enzymes [BR:pbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PAAG_06464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 727 aa AA seqDB search
MKTSLLSWSLLSLILNPVTSTSTSNTGSDDFSKKPSAPQANVQADKSPGSSHTVFNGVEV
PPMKELNATNFDETIKEGYWFVKHYSPYCPYCLDIAPTWQTLYEFYYTSNPLSASTSKQG
PAAQSSLNSFNGFYNFHFASMDCIANADKCQALKVAAFPMFILYYKGEKLESFIGKKSIK
AMSEFIEEKLEHIKPGSRPLKGLKLPKPGDTKVDPTPLSDTSGSKLESKPEGKSETSTPV
STTSGKPQSARPLPNPQGTSIPLTAESFQKLVTTTHVPWFIKFYTQWCSHCQAMAPSWEQ
MSKDMKGILNVGEVNCETERRLCKDARVSSYPTIYFFRGGERVEYHGLRGLGDLVSYARK
AAEVVGNGVQYVDAAAFKEMEQTEEVIFLYFFDKATTSEDFAALDRLTLSLVGRARLVKT
DSEILATRFRISTWPRLLVSRDGKPSYYNALAPKDMRDFRQVLSWMESVWLPIVPELTAT
NAREILPGKFVVLGILSRLRSDEFIQDKKELKNAALEWMDKQTKLFQLERQELRDAKELR
IEEAEDRNDQRALRAAKNRQITIRESDKKQVVFAWVDGIFWDRWLRTTYGIDVRNGERVI
INDEDNRRYWDTTTSGAYIMPSRTSILDTITQVISPSSKLKPKSTVGFFEGLFFKTRSFI
HAHPFIFIALIFLVLAFSSLCVKGRLRRLRGAGGLLGAVTGTSGGGFFHLDGKEGLLGVG
NSSGKVD
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgtcactcctttcatggtcattactttccttgattttgaatcccgtcacctca
acctcgacgagcaacactggatccgacgatttttcgaaaaagccatcagctccccaggcg
aacgtccaagcagacaaatcaccgggaagctctcacacggtgtttaatggcgtcgaagtt
cccccaatgaaagagcttaatgcgactaattttgatgaaactattaaggagggttactgg
tttgtgaagcattactctccatattgcccgtattgcttggacatcgctccaacgtggcaa
acgctatacgaattctattatacctcaaatcccctatcggcctcaacatccaagcaaggc
ccggctgcgcaatcctccctgaattcctttaatgggttctacaactttcatttcgcttca
atggactgcatcgcaaatgcagataaatgccaggcgcttaaagtggctgcattccccatg
ttcatactctactacaagggtgagaagttggaatcctttattggtaaaaagtcaatcaaa
gccatgagcgagtttatcgaggagaaattggaacacattaagcccggttcaagacccctg
aagggtctaaagctaccgaaacctggcgataccaaggttgatccaactccgcttagtgat
acatcgggatccaaactcgaatcaaaaccagaaggaaaatcagaaacttcaactcctgtg
tcgacaacaagtggaaagccccagtctgcgcggcccttgcccaaccctcaaggcacatcg
atccccctcacggctgaaagtttccagaaactggtcacaaccactcatgttccatggttt
atcaagttctatacacaatggtgcagccattgccaggccatggctccctcatgggaacag
atgtccaaggatatgaaaggtattttaaatgttggcgaagttaactgtgagactgagcgg
cgattgtgcaaagatgcccgcgttagctcctatccaactatttactttttcaggggtgga
gagcgtgtcgagtatcacgggcttagaggcctgggagacctggtcagctacgctagaaag
gcagccgaagttgtgggcaacggcgttcaatatgttgatgcagctgcctttaaggaaatg
gagcaaacagaagaggtaattttcttgtatttcttcgacaaggctaccacttcagaggac
tttgccgccctggaccgcttaactttgagcttagtgggacgtgcaaggctggtcaagacc
gatagcgagattctcgctacgagattcagaatttctacctggcctcgtcttctcgtctcg
agagatgggaaacccagttactacaacgcccttgcgcctaaagatatgcgagatttccga
caggttcttagctggatggaaagcgtgtggcttccaattgtcccagagcttacagcgacg
aacgctcgcgagatcctccctggaaaatttgtggtccttggtatcctcagtcgactgcgc
tcagatgaattcatccaggataaaaaggagctgaaaaatgctgcgcttgagtggatggat
aaacagacgaaattattccaacttgagcgccaggaacttcgagacgcgaaagaattgcgt
atcgaagaggcagaggaccgaaatgaccagcgagcgctccgtgcagcaaaaaatagacaa
atcaccatccgggagagcgataaaaaacaggtcgttttcgcatgggtcgacggtatattc
tgggatcgatggcttcgtacaacttatggtattgatgttagaaacggagaacgtgtcatc
atcaatgacgaggacaatcgccgatactgggacaccaccacaagcggtgcctacatcatg
cccagccgtacctccattctcgacaccatcacccaagtcatctccccatcctcgaagctt
aagccgaaatccacagttggtttctttgaaggcctattcttcaaaacacgctcctttatt
catgctcaccctttcatattcattgctctcatcttccttgttttggcattctcatccctt
tgcgtgaagggtagattaagaagactcagaggtgctggggggctccttggtgccgtcact
ggtacctcaggtggtggattcttccacctcgatggaaaggagggcctgcttggtgttgga
aacagttcagggaaagttgactag

DBGET integrated database retrieval system