KEGG   Paracoccidioides brasiliensis: PAAG_06490Help
Entry
PAAG_06490        CDS       T02230                                 

Definition
serine/threonine-protein kinase ppk15
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAAG_06490
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PAAG_06490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 868 aa AA seqDB search
MDPQWQAYADATSGRPGQFNNGLGGGHAHQLTQKYPAVNPGNGTQSQQHQAQAPTGYTYE
SYQTPGTAPKAPSGNLTTSKTVSMTSSPAPLVTDDFRDTDVTMEDADPYNRTKYPTRPTH
HHHSSLQLLSSEESSAARRYSPMNVITPSVPYNSSPNTSQNPYTYHPAGSSNNRPSPTRA
STFSSPPQNYQSQSSGTSRQQSRLPAVQPAEMSSEQYYPQSATSQLGAAFSQDLNLHRGQ
SQQHMSQQQQQQHKRGPVPRFVKIKSTQELKPRINAQPAFRRANPEGGFISPLQALTTHL
PSSYRICNPSFKYESSRNPRRVLTKPSKGVKNDGYDNDDSDYILYVNDILGSQGTFGQVV
KCQNLKTQEVVAVKVVKNRTAYFNQSMMEVSVLDLINSKLDKNDDHHLLRLRDTFIHRQH
LCLVFELLSVNLYELIKQNQFRGLSTTLVRVFTQQLLNGLSLLNKARLIHCDLKPENILL
KKYSSAIDMWSLGCIVVELFLGLPLFPGSSEYNQVSRITEMLGMPPNWMLEMGKQAGEFF
EKTQDEFGRRSYRLKSMEQYSREHNTKEQPSKKYFQATTLPEIIRSYSMPRKNMKQAEID
REMNNRVAFIDFVRGLLNINPLERWSPQQAKLHPFITQQKYTQPFVPPMNLKSSALNKTV
APGVQQQQQAEAASKQRAAQAQAQAQSAAQAQSYALQMNNHFQQPTHGQPATVYNSMYTP
HQQGAPPPYPSQPSAYSHQMPIMQQASHIPQQQFNASQSLYAQATTRAGRQRASTMDQQQ
GGIPPSIQRVASHLDPNAPIRLQPSPAYYPPPADGYVGDSSAAAAVAGRRRGSRTTASGA
HGRSNRDFIRTLEDGAMGDGFMGQNQWH
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggacccgcagtggcaggcctatgctgatgccacttctggccgtccaggccaatttaac
aatggccttggaggaggtcacgcccatcagctgacgcagaaatacccagctgtgaatcct
ggcaatggaacgcaatctcaacagcatcaagcccaagccccaaccggatatacatacgag
tcataccaaacaccaggaacagcacctaaggcaccctcgggtaatttaacgacatcaaaa
accgtgtcaatgacctcgtctccagctcctctcgtcactgacgacttcagagatacggat
gttactatggaagatgccgacccttacaaccgtactaaataccctaccagaccgactcat
catcatcacagttctttacaacttctctcgagtgaagaatcctctgctgcgcgcagatat
tcccccatgaacgtgatcactccctcagtgccttacaattctagccccaatacctcgcaa
aatccatacacctaccatccagcagggtcgtcgaacaatcgaccgtcaccaacgagagca
agcacattttcttctccgccccaaaattaccaatctcaatcttctggaacttcacgtcag
caatctcgtttacctgcggtccagccagcggaaatgagttccgaacaatattacccgcaa
tctgcgacttctcagctaggtgctgcgtttagccaagatttgaatttacatagaggacag
tcccaacaacacatgtcgcaacagcaacaacagcagcacaaaaggggtccagtaccgagg
tttgtgaagattaagtctacacaggaattaaaaccaaggataaatgctcaaccagcgttc
cggcgcgccaatcctgagggaggattcatcagtcctttacaagctctaacgacacattta
ccctcgagctatcgaatatgtaacccgtcatttaaatacgaatcttcgaggaatccccgt
cgggtcttaaccaaacccagtaaaggcgtcaaaaatgatggttatgataatgatgacagt
gattatatcctatatgtcaatgatattcttgggagccaggggacatttggtcaagttgtg
aaatgccaaaatctcaagacgcaagaggttgtggcggtcaaagttgtgaaaaacagaaca
gcatacttcaaccagagcatgatggaagtgtcggttttggatctaatcaatagcaaactt
gataagaacgatgaccaccatcttctccgcctaagggatacctttatccatcgacaacat
ctctgcttagtgttcgagctgctcagcgtgaatttgtatgagcttatcaaacagaatcaa
ttccgtggtcttagcacgacccttgtgcgggtatttacacagcaattactcaatggcctc
tcactcctgaacaaagctcgactaatacactgcgatctaaaacccgaaaatatattgttg
aaaaagtattcgtccgctattgatatgtggtcattaggttgtatcgtcgttgagcttttc
ctgggccttccattgttccccgggtcttctgagtacaaccaagtatctcggatcacagaa
atgctaggaatgcctccgaattggatgcttgagatgggaaagcaagccggggagtttttt
gaaaaaacgcaggacgaatttggtcgtcgaagttatagactgaaaagcatggagcagtat
tcccgcgaacacaacacgaaagagcaaccaagcaaaaagtatttccaggcaacgacattg
ccggaaattatccgaagctactcaatgccgaggaaaaatatgaagcaggcggagattgat
agagaaatgaataaccgcgtcgcatttatcgatttcgttcgcggacttttgaacataaac
ccccttgagagatggtcacctcaacaagcaaaacttcaccccttcataacgcaacaaaag
tacacacaacctttcgtacctccaatgaaccttaagtcctcagcattgaacaagacagtt
gcccctggtgtacaacaacaacaacaagcagaagctgccagcaagcagcgtgccgcacag
gcccaagctcaagcccagtctgccgcgcaagcacaatcctacgctctccagatgaacaac
catttccagcaacctacacacggccagccagccacagtatacaatagcatgtacactcca
catcaacaaggcgcacccccaccctatccctcccagcccagtgcatatagccatcaaatg
ccaataatgcaacaagctagccacatcccacagcaacaatttaacgcctcacaaagcctt
tacgcgcaagctaccacccgagctgggcgccaacgggcctcgaccatggaccagcaacaa
ggtggtatacccccgtcaatccaaagagtcgcaagccatcttgatcccaacgccccgatc
cgattacagcctagtccagcctactacccgccacccgctgacgggtatgttggcgattct
tctgccgctgccgcggtggcaggacggcggaggggaagtcgtactactgccagtggggcc
catggaaggagtaatagagatttcatccggacacttgaggatggggcgatgggggatggg
tttatggggcaaaatcagtggcattga

DBGET integrated database retrieval system