KEGG   Paracoccidioides lutzii Pb01: PAAG_06490Help
Entry
PAAG_06490        CDS       T02230                                 

Definition
(RefSeq) serine/threonine-protein kinase ppk15
  KO
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PAAG_06490
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PAAG_06490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 924 aa AA seqDB search
MDPQWQAYADATSGRPGQFNNGLGGGHAHQLTQKYPAVNPGNGTQSQQHQAQAPTGYTYE
SYQTPGTAPKAPSGNLTTSKTVSMTSSPAPLVTDDFRDTDVTMEDADPYNRTKYPTRPTH
HHHSSLQLLSSEESSAARRYSPMNVITPSVPYNSSPNTSQNPYTYHPAGSSNNRPSPTRA
STFSSPPQNYQSQSSGTSRQQSRLPAVQPAEMSSEQYYPQSATSQLGAAFSQDLNLHRGQ
SQQHMSQQQQQQHKRGPVPRFVKIKSTQELKPRINAQPAFRRANPEGGFISPLQALTTHL
PSSYRICNPSFKYESSRNPRRVLTKPSKGVKNDGYDNDDSDYILYVNDILGSEEANHKNR
YLILDVLGQGTFGQVVKCQNLKTQEVVAVKVVKNRTAYFNQSMMEVSVLDLINSKLDKND
DHHLLRLRDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFTQQLLNGLSLLN
KARLIHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYS
SAIDMWSLGCIVVELFLGLPLFPGSSEYNQVSRITEMLGMPPNWMLEMGKQAGEFFEKTQ
DEFGRRSYRLKSMEQYSREHNTKEQPSKKYFQATTLPEIIRSYSMPRKNMKQAEIDREMN
NRVAFIDFVRGLLNINPLERWSPQQAKLHPFITQQKYTQPFVPPMNLKSSALNKTVAPGV
QQQQQAEAASKQRAAQAQAQAQSAAQAQSYALQMNNHFQQPTHGQPATVYNSMYTPHQQG
APPPYPSQPSAYSHQMPIMQQASHIPQQQFNASQSLYAQATTRAGRQRASTMDQQQGGIP
PSIQRVASHLDPNAPIRLQPSPAYYPPPADGYVGDSSAAAAVAGRRRGSRTTASGAHGRS
NRDFIRTLEDGAMGDGFMGQNQWH
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggacccgcagtggcaggcctatgctgatgccacttctggccgtccaggccaatttaac
aatggccttggaggaggtcacgcccatcagctgacgcagaaatacccagctgtgaatcct
ggcaatggaacgcaatctcaacagcatcaagcccaagccccaaccggatatacatacgag
tcataccaaacaccaggaacagcacctaaggcaccctcgggtaatttaacgacatcaaaa
accgtgtcaatgacctcgtctccagctcctctcgtcactgacgacttcagagatacggat
gttactatggaagatgccgacccttacaaccgtactaaataccctaccagaccgactcat
catcatcacagttctttacaacttctctcgagtgaagaatcctctgctgcgcgcagatat
tcccccatgaacgtgatcactccctcagtgccttacaattctagccccaatacctcgcaa
aatccatacacctaccatccagcagggtcgtcgaacaatcgaccgtcaccaacgagagca
agcacattttcttctccgccccaaaattaccaatctcaatcttctggaacttcacgtcag
caatctcgtttacctgcggtccagccagcggaaatgagttccgaacaatattacccgcaa
tctgcgacttctcagctaggtgctgcgtttagccaagatttgaatttacatagaggacag
tcccaacaacacatgtcgcaacagcaacaacagcagcacaaaaggggtccagtaccgagg
tttgtgaagattaagtctacacaggaattaaaaccaaggataaatgctcaaccagcgttc
cggcgcgccaatcctgagggaggattcatcagtcctttacaagctctaacgacacattta
ccctcgagctatcgaatatgtaacccgtcatttaaatacgaatcttcgaggaatccccgt
cgggtcttaaccaaacccagtaaaggcgtcaaaaatgatggttatgataatgatgacagt
gattatatcctatatgtcaatgatattcttgggagtgaggaagccaaccataagaatcga
tatcttattttggatgttctaggccaggggacatttggtcaagttgtgaaatgccaaaat
ctcaagacgcaagaggttgtggcggtcaaagttgtgaaaaacagaacagcatacttcaac
cagagcatgatggaagtgtcggttttggatctaatcaatagcaaacttgataagaacgat
gaccaccatcttctccgcctaagggatacctttatccatcgacaacatctctgcttagtg
ttcgagctgctcagcgtgaatttgtatgagcttatcaaacagaatcaattccgtggtctt
agcacgacccttgtgcgggtatttacacagcaattactcaatggcctctcactcctgaac
aaagctcgactaatacactgcgatctaaaacccgaaaatatattgttgaaaaatctcgaa
agtccgataattaaaattatcgacttcggatcagcatgcgatgagagacaaacagtgtac
acatacattcaatcgagattttatcgctcgcccgaggtgcttctaggactaccgtattcg
tccgctattgatatgtggtcattaggttgtatcgtcgttgagcttttcctgggccttcca
ttgttccccgggtcttctgagtacaaccaagtatctcggatcacagaaatgctaggaatg
cctccgaattggatgcttgagatgggaaagcaagccggggagttttttgaaaaaacgcag
gacgaatttggtcgtcgaagttatagactgaaaagcatggagcagtattcccgcgaacac
aacacgaaagagcaaccaagcaaaaagtatttccaggcaacgacattgccggaaattatc
cgaagctactcaatgccgaggaaaaatatgaagcaggcggagattgatagagaaatgaat
aaccgcgtcgcatttatcgatttcgttcgcggacttttgaacataaacccccttgagaga
tggtcacctcaacaagcaaaacttcaccccttcataacgcaacaaaagtacacacaacct
ttcgtacctccaatgaaccttaagtcctcagcattgaacaagacagttgcccctggtgta
caacaacaacaacaagcagaagctgccagcaagcagcgtgccgcacaggcccaagctcaa
gcccagtctgccgcgcaagcacaatcctacgctctccagatgaacaaccatttccagcaa
cctacacacggccagccagccacagtatacaatagcatgtacactccacatcaacaaggc
gcacccccaccctatccctcccagcccagtgcatatagccatcaaatgccaataatgcaa
caagctagccacatcccacagcaacaatttaacgcctcacaaagcctttacgcgcaagct
accacccgagctgggcgccaacgggcctcgaccatggaccagcaacaaggtggtataccc
ccgtcaatccaaagagtcgcaagccatcttgatcccaacgccccgatccgattacagcct
agtccagcctactacccgccacccgctgacgggtatgttggcgattcttctgccgctgcc
gcggtggcaggacggcggaggggaagtcgtactactgccagtggggcccatggaaggagt
aatagagatttcatccggacacttgaggatggggcgatgggggatgggtttatggggcaa
aatcagtggcattga

DBGET integrated database retrieval system