KEGG   Paracoccidioides brasiliensis: PAAG_06780Help
Entry
PAAG_06780        CDS       T02230                                 

Definition
repressible alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAAG_06780
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PAAG_06780
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAAG_06780
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 614 aa AA seqDB search
MSDPLLVQRSSSEHSSIRTGEADALLTGERTYRDEERSRSSIWREIGLFAWALFATVALI
IVAVLYQHQAQKNASGSGKLGPGEKPTGKRNLIFMVSDGMGPASLSLTRSFRQFESHLPI
DDILVLDQHHIGTSRTRSSSSLITDSAAGATAFSCGKKSYNGAISVLPDHTPCGTVLEAA
KQAGYMTGIVVTTRITDATPACFASHANMRSYEDLIALHEIGEYPLGRVVDLMIGGGRCH
FLANSTDGSCREDDKDVVKLAKAKGFSYIDDWVGFDHLRMGENVNLPLLGLLAPKDIPYE
IDRRLLNNVYPSLEEMTRMALKALSKATKDSDQGFFIMIEGSRIDHAGHGNDPAAQVHEV
LAYDKAFSAVLEFLEKDSTPGILVATSDHETGGLSIARQLHSSQYPTYLWYPGVLANASH
SSEYLSNTLDAYLDGAGKGASKPERQKYVRKKLLADGLGIHDATDFEVDKLINGGGAYTF
ADMISRRAQIGWSTHGHSAVDVNIYASSPSDALSLMGNHENTEIGLFLADYLNIDLESVT
KQLQTTRSSSHVTDDGNVKPYAWMGPPLDDGVVVDKLDTYHGDFKRKKRDDSVNHLVLEN
RNFDGHNCGCGSKH
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctctgctcgtgcagcgctcctcctccgagcattcgtcgatccgaacaggc
gaggccgacgctctcttaaccggtgaacggacataccgcgatgaagaaaggagtcgctct
tccatatggcgtgagattgggctctttgcctgggctctcttcgctactgtcgctctcatc
atcgtcgcagtcctctaccaacaccaagcacaaaagaacgcatcgggctcagggaaattg
ggccctggcgagaagcctacggggaaaaggaatctgatattcatggtatctgatgggatg
ggcccggcaagtttatcgctgactcgaagtttccgacaattcgagagccacctgcctatc
gatgatatccttgtcctagaccagcaccatatcggaacctcgagaactagatcctcatct
agtttaattaccgattctgcagctggcgcaactgcgttttcctgcgggaagaagagctat
aatggcgccatctctgttcttccggatcatactccgtgtggtacggttcttgaggccgca
aaacaggctggttatatgactggtatagtcgtaacaactcgaattactgatgctacacca
gcttgttttgcttctcatgctaacatgcggtcctacgaagatcttattgctttgcatgag
attggagagtatcctcttggtcgagtggttgacctaatgattgggggtggacgttgtcat
ttcttggcaaattccaccgacgggagctgccgtgaagatgacaaagacgtggtgaagcta
gctaaagctaagggattctcatatatcgatgattgggtgggatttgaccatcttagaatg
ggcgaaaatgttaatctcccgcttcttggccttctggcaccaaaggacattccctatgaa
atagaccgccgcctgctgaacaatgtgtatccatctctagaggagatgacacgtatggct
ctaaaggcattaagcaaagctaccaaagatagcgaccagggtttcttcatcatgatagag
ggttcaaggatagaccatgcaggccatggaaatgatccagcagcccaagtccacgaagtt
ctcgcttatgataaagcgttctccgcagttctggagtttcttgagaaagattctaccccc
ggaatcctcgttgccacgtcagaccacgagactggcgggttgtctatcgctagacaactc
cactcctctcagtatccaacatatctctggtatcctggcgtgctcgcaaacgccagccat
tcctctgagtatcttagtaataccttagacgcctatctcgacggcgctggcaaaggtgca
agcaaaccagagcgtcaaaaatatgtccgcaaaaagctactggctgatggattaggcatc
catgacgcaaccgactttgaggttgataaactgataaatggtggtggcgcttatactttt
gcagacatgattagtcgacgagcccaaattggctggtccacgcatggacattctgctgtc
gatgtgaacatctacgcctcctcgcctagcgatgccctctccctaatggggaaccatgaa
aataccgaaattggcttattcctcgcggactacctcaatattgacctggagagcgttacc
aagcagctgcaaaccacacgttcgtcttcacatgtcactgatgatggcaatgttaagcct
tatgcttggatgggcccaccacttgacgatggcgtagtcgttgataaactcgacacttac
catggcgatttcaaacgaaagaagcgtgatgactctgtcaatcatcttgttcttgagaat
cgaaatttcgacgggcataattgtggatgtggttcgaaacattaa

DBGET integrated database retrieval system