KEGG   Paracoccidioides brasiliensis: PAAG_06808Help
Entry
PAAG_06808        CDS       T02230                                 

Definition
histone deacetylase phd1
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PAAG_06808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MARSAIVQEYAPPPVAQTTLTTDRKTAHEIENEDFKRPKGYTVSWHANPLVEPHHFGSSH
PMKPWRLTLTKQIVMAYGMHHAMDLYKTRQATYEEMAEFHSSEYLDFLQSVIPADMDDTA
LSDRISSFNIGDDCPVFDGLFDYCSHYAGGTLDAARKLCNNQSAIAINWSGGLHHAKKSE
ASGFCYINDIVLGILQLLRLYPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKTNF
FPGTGGLDDTGPPNPLNPGAHHALNVPLHDGIEDGDYISLFQSIIGPCIRTYQPGAIVLQ
CGADSLGCDRLGCFNLNIRAHGACVAYTKTFGLPTLVLGGGGYTPRNVSRLWAYETAICI
DAASQLNPKLPDCLPFRNHFKPDCTLFPPLSDMRRLENRNTKAYLEIVTQTVLEQLRYLK
GAPSVQMRHIPPDIMGLREDVEKEIEEEKERMEAEQEEREGAGSSGGKCSKRKGLEKGLG
ISGELYA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgagatcagcgattgtccaggaatacgctcctccgcctgtggcccaaacgacccta
acaacggaccgcaagactgcgcatgaaatagagaatgaagattttaagcgcccaaaggga
tacacagtgtcatggcatgcaaaccctttagtcgagccgcatcactttggctcgtcgcat
cccatgaaaccatggcgactgaccttgaccaaacaaattgtcatggcctatggcatgcac
catgccatggatctgtacaagacgcgccaggccacctatgaagagatggccgaattccac
agctcagaatatctcgatttcctccaatcggtcatcccagcagacatggacgacacggcg
ctcagcgatcgcatctccagcttcaacattggcgacgactgtcccgtcttcgacggtctt
ttcgactactgctcacactatgccggcggcactcttgacgccgcacgcaagctctgcaac
aaccaatccgcaatcgccatcaactggtccggcggcctccaccacgccaagaaatccgaa
gccagcggcttctgctacatcaacgacatcgtcctgggcatcctgcaactcctccgcctg
tacccgcgtgtaatgtacatagacatagacgttcaccacggcgacggtgtcgagcaggcg
ttctggtccacagaccgcgtcctcaccgtctccttccacaagtacgacaagacaaacttc
ttccccggcacggggggcctggatgacacgggtccgccaaacccactcaacccaggcgcg
caccatgctctcaacgtaccactgcatgacggcatagaagacggcgactacatctccctc
ttccaatccatcatcggcccctgcatccgcacctaccaacccggcgccatcgtcctgcaa
tgcggcgcggacagtctggggtgtgacagactaggctgcttcaacctcaacatccgcgcg
catggcgcctgcgtcgcatacacgaagacattcggcctaccaaccctcgtcttgggtggg
ggcgggtacacaccgcgcaacgtctcgcgactctgggcctacgaaacagcaatctgcatc
gacgccgcgtcccagctaaacccaaagctgccggattgtctccccttccgcaaccatttc
aagcccgactgcacgctcttcccgccgttgtcggacatgcggaggctggagaatcgcaac
accaaagcgtatctggagatcgttacgcagacggtgctggagcaactgcggtatctcaag
ggcgcgccgagtgtgcagatgcgccatattccgccggatattatgggattacgggaagat
gttgagaaggagattgaggaggagaaggaaaggatggaggcggagcaggaggagagggaa
ggggcggggagtagtggggggaaatgcagtaaaaggaagggtttggagaagggtttgggg
attagcggggagttgtatgcctga

DBGET integrated database retrieval system