KEGG   Paracoccidioides lutzii Pb01: PAAG_06817Help
Entry
PAAG_06817        CDS       T02230                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00040  Pentose and glucuronate interconversions
pbl00052  Galactose metabolism
pbl00500  Starch and sucrose metabolism
pbl00520  Amino sugar and nucleotide sugar metabolism
pbl01100  Metabolic pathways
pbl01130  Biosynthesis of antibiotics
Module
pbl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAAG_06817
   00052 Galactose metabolism
    PAAG_06817
   00500 Starch and sucrose metabolism
    PAAG_06817
   00520 Amino sugar and nucleotide sugar metabolism
    PAAG_06817
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAAG_06817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 9094573
NCBI-ProteinID: XP_015700455
UniProt: C1H7S6
Position
Unknown
AA seq 507 aa AA seqDB search
MAISIPGVRNGVADHDCDTQAFENASTNVAASQMRNALNALADTVTDPKEKKRFEAEMDN
FFSLFRRYLNDKAKGNVLSWDSIAPPQPGQVVEYSDLGNSASVNFLKKLAVIKLNGGLGT
SMGCVGPKSVIEVRDGMSFLDLAVRQIEYLNRTYDVSVPFVLMNSFNTDEDTQSIIKKYE
GHNIDILTFNQSRYPRILRDSLLPAPKTYQSPITDWYPPGHGDVFESLYNSGTLDKLLDR
GVEIVFLSNADNLGAVVDMRILEHMVKNKAEYIMELTDKTKADVKGGTIIDYEGRARLLE
IAQVPKEHVNEFKSIKKFKYFNTNNIWMDLRAIKRVVENNELEMEIIPNEKSIPADRKGE
ADISIIQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLMLVKSDLYTLKHGQLVIDP
NRFGGTPLIKLGRDFKKVSDFQKRIPSIPRILELDHLTISGVVNLGRGVILKGTVIIVAT
EGSTIDIPPGSVLENVVVQGSLRILEH
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcgattagcatccctggagtacgcaacggtgttgctgatcatgactgtgatacccag
gccttcgagaatgcgtccaccaacgttgcagcctcccagatgcgcaacgctctcaatgcg
ctggccgataccgtgacagaccccaaggaaaagaagcgtttcgaggcagagatggataac
ttcttttcactcttccgacggtatctgaatgacaaggccaagggtaatgtcctgtcatgg
gattccatcgcgccacctcaaccaggccaagtcgtcgagtacagcgatctaggcaattct
gcctccgtcaactttttgaaaaagctggctgtgatcaagctgaacggaggtctcgggact
tccatgggctgcgttggacctaaatctgttatcgaggttagagacggcatgtccttcctg
gacttggctgtccggcaaatcgaatacctgaaccgcacctacgacgtgagcgtgcctttt
gtgctcatgaactccttcaacaccgacgaggacacacagtcgatcatcaagaagtacgaa
ggacacaatattgacatcctgaccttcaaccaatcgagatacccccgcatcctgagagat
tccctcctacccgctcctaagacctatcagtcccctatcactgactggtacccccccggc
cacggtgacgtcttcgagtcactctacaactccggaaccttggacaagctcctggaccga
ggagtggagattgtcttcctctccaacgcagacaacttgggtgctgttgtcgatatgcgc
attctggaacacatggtgaagaacaaggcggaatatatcatggagttgacagacaagacc
aaggctgacgtaaagggtggcaccatcattgattacgagggccgggcccgcttgctcgag
atcgctcaggtaccaaaggagcacgtgaatgaattcaagtcgatcaagaagttcaagtac
ttcaacaccaacaatatctggatggatctgcgcgctatcaagcgcgtcgtcgagaacaac
gaactggaaatggagattattcccaacgaaaagtctatcccagcagaccgcaagggagag
gcggacatctctatcattcaacttgaaactgccgtgggcgccgccatccgacatttcaag
aacgcccacggagtcaacgtcccacgccgtcgtttcctgcccgtaaagacctgctccgat
ctcatgctcgtcaagtccgacctgtacaccctcaaacatggccaattggtcatcgatccc
aaccggttcggaggcacgcctcttatcaagctcgggagagatttcaagaaagtctccgat
ttccagaagcggattcctagcattcctcgaatcctcgagcttgaccacctcacgattagc
ggtgtggttaatcttggccgtggggttatattgaaagggactgttatcatcgtagccacc
gaaggcagcactattgatatcccgcctggctcagttctggagaacgtcgttgtgcagggg
agcttgaggatcctggagcattaa

DBGET integrated database retrieval system