KEGG   Paracoccidioides brasiliensis: PAAG_06817Help
Entry
PAAG_06817        CDS       T02230                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAAG_06817
   00052 Galactose metabolism
    PAAG_06817
   00500 Starch and sucrose metabolism
    PAAG_06817
   00520 Amino sugar and nucleotide sugar metabolism
    PAAG_06817
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAAG_06817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 525 aa AA seqDB search
MASRAIPSHLRAPRLWHRPKVQTAPLNGKHHGKSQSHMAFENASTNVAASQMRNALNALA
DTVTDPKEKKRFEAEMDNFFSLFRRYLNDKAKGNVLSWDSIAPPQPGQVVEYSDLGNSAS
VNFLKKLAVIKLNGGLGTSMGCVGPKSVIEVRDGMSFLDLAVRQIEYLNRTYDVSVPFVL
MNSFNTDEDTQSIIKKYEGHNIDILTFNQSRYPRILRDSLLPAPKTYQSPITDWYPPGHG
DVFESLYNSGTLDKLLDRGVEIVFLSNADNLGAVVDMRILEHMVKNKAEYIMELTDKTKA
DVKGGTIIDYEGRARLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMDLRAIKRVVENNEL
EMEIIPNEKSIPADRKGEADISIIQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLM
LVKSDLYTLKHGQLVIDPNRFGGTPLIKLGRDFKKVSDFQKRIPSIPRILELDHLTISGV
VNLGRGVILKGTVIIVATEGSTIDIPPGSVLENVVVQGSLRILEH
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccgggcaatcccttcgcaccttcgagcccccaggctctggcaccggcccaaa
gtgcagacggctccgctgaacggaaaacatcatggcaagtcgcagtcacacatggccttc
gagaatgcgtccaccaacgttgcagcctcccagatgcgcaacgctctcaatgcgctggcc
gataccgtgacagaccccaaggaaaagaagcgtttcgaggcagagatggataacttcttt
tcactcttccgacggtatctgaatgacaaggccaagggtaatgtcctgtcatgggattcc
atcgcgccacctcaaccaggccaagtcgtcgagtacagcgatctaggcaattctgcctcc
gtcaactttttgaaaaagctggctgtgatcaagctgaacggaggtctcgggacttccatg
ggctgcgttggacctaaatctgttatcgaggttagagacggcatgtccttcctggacttg
gctgtccggcaaatcgaatacctgaaccgcacctacgacgtgagcgtgccttttgtgctc
atgaactccttcaacaccgacgaggacacacagtcgatcatcaagaagtacgaaggacac
aatattgacatcctgaccttcaaccaatcgagatacccccgcatcctgagagattccctc
ctacccgctcctaagacctatcagtcccctatcactgactggtacccccccggccacggt
gacgtcttcgagtcactctacaactccggaaccttggacaagctcctggaccgaggagtg
gagattgtcttcctctccaacgcagacaacttgggtgctgttgtcgatatgcgcattctg
gaacacatggtgaagaacaaggcggaatatatcatggagttgacagacaagaccaaggct
gacgtaaagggtggcaccatcattgattacgagggccgggcccgcttgctcgagatcgct
caggtaccaaaggagcacgtgaatgaattcaagtcgatcaagaagttcaagtacttcaac
accaacaatatctggatggatctgcgcgctatcaagcgcgtcgtcgagaacaacgaactg
gaaatggagattattcccaacgaaaagtctatcccagcagaccgcaagggagaggcggac
atctctatcattcaacttgaaactgccgtgggcgccgccatccgacatttcaagaacgcc
cacggagtcaacgtcccacgccgtcgtttcctgcccgtaaagacctgctccgatctcatg
ctcgtcaagtccgacctgtacaccctcaaacatggccaattggtcatcgatcccaaccgg
ttcggaggcacgcctcttatcaagctcgggagagatttcaagaaagtctccgatttccag
aagcggattcctagcattcctcgaatcctcgagcttgaccacctcacgattagcggtgtg
gttaatcttggccgtggggttatattgaaagggactgttatcatcgtagccaccgaaggc
agcactattgatatcccgcctggctcagttctggagaacgtcgttgtgcaggggagcttg
aggatcctggagcattaa

DBGET integrated database retrieval system