KEGG   Paracoccidioides lutzii Pb01: PAAG_06948Help
Entry
PAAG_06948        CDS       T02230                                 

Definition
(RefSeq) mitogen-activated protein kinase MKC1
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
MAPK signaling pathway - yeast
Regulation of mitophagy - yeast
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PAAG_06948
 Cellular Processes
  Transport and catabolism
   04139 Regulation of mitophagy - yeast
    PAAG_06948
Enzymes [BR:pbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PAAG_06948
Protein kinases [BR:pbl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PAAG_06948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 428 aa AA seqDB search
MTDLPGRKVFKVFNQEFVVDERYNVTKELGQGAYGIVCAATNIQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPENFNETYLYEGKCFLLMECDLAAIIR
SGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSI
DPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVD
QLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMHKIPFQRLFPSANPDALDLLDRMLA
FDPSSRISVEEALEHRYLHIWHDATDEPSCPTTFDFHFEVVDDVPEMRRMILDEVVRFRQ
QVRQSSQTQGSAAGQQAAQQAQQNVPIPEDHSGVWKQEDPRPQEAVLDSSRNPNDLEASL
QRGMDVVR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttaccaggacgcaaggtatttaaggtgttcaaccaagagtttgtggttgat
gagcgatacaacgtgacaaaggagttgggacagggcgcgtatggtattgtctgtgccgcc
acgaacatccaaaccggggaaggtgttgcaatcaagaaagtgacaaacgtgttcagtaag
aaaatcttggcaaagcgcgcactgcgtgagattaaactgctccagcatttccgcggtcat
cgcaatatcacgtgtttgtatgacatggatatacccagaccagagaatttcaacgagacc
tacctgtacgaaggcaagtgctttttgttgatggagtgcgatctggctgcaatcatccgg
tcgggacagcccttaacagatgctcacttccagtccttcatttaccaaatactttgtgga
ttaaaatacatccattccgccaatgtcttgcatcgagatctaaagccgggtaatttgcta
gttaatgctgactgcgagctgaaaatttgcgactttggcttggctcgtggcttctccatc
gatccggatgagaatgctggctatatgactgaatacgttgccacgcgatggtaccgtgcc
cctgaaatcatgttaagctttccaagctacaccaaagctattgatgtatggtctgttggt
tgtattctggctgaactcctaggtggccggcctttcttcaaaggccgtgattacgttgac
caacttaatcaaatccttcactaccttggaacacccaatgaagaaaccctctcccgcatt
ggctccccgcgagcgcaagaatacgtcaggaatctcccattcatgcacaaaatccctttc
cagcgcctctttccgagtgcgaacccggacgctctggaccttctagatcgaatgctggcc
tttgatccgtcttcccgtatctctgtcgaagaggctcttgaacaccgctacctgcatatc
tggcacgatgcgactgatgagccatcatgccccacgaccttcgacttccactttgaggtt
gttgatgatgtaccagagatgaggaggatgattttggatgaagtcgtccgattccgccag
caagtaagacagagttctcagacgcagggtagtgcggctgggcaacaggcggctcagcag
gctcaacaaaatgttccaatcccggaagatcattctggagtctggaagcaggaagatccc
cggccacaggaggctgttcttgatagctctagaaatccgaatgaccttgaagcatcactc
cagagaggaatggacgttgttagatga

DBGET integrated database retrieval system