KEGG   Paracoccidioides brasiliensis: PAAG_06948Help
Entry
PAAG_06948        CDS       T02230                                 

Definition
mitogen-activated protein kinase MKC1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pbl04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 431 aa AA seqDB search
MTDLPGRKVFKVFNQEFVVDERYNVTKELGQGAYGIVCAATNIQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPENFNETYLYEGKCFLVAQLMECDLAA
IIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARG
FSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRD
YVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMHKIPFQRLFPSANPDALDLLDR
MLAFDPSSRISVEEALEHRYLHIWHDATDEPSCPTTFDFHFEVVDDVPEMRRMILDEVVR
FRQQVRQSSQTQGSAAGQQAAQQAQQNVPIPEDHSGVWKQEDPRPQEAVLDSSRNPNDLE
ASLQRGMDVVR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttaccaggacgcaaggtatttaaggtgttcaaccaagagtttgtggttgat
gagcgatacaacgtgacaaaggagttgggacagggcgcgtatggtattgtctgtgccgcc
acgaacatccaaaccggggaaggtgttgcaatcaagaaagtgacaaacgtgttcagtaag
aaaatcttggcaaagcgcgcactgcgtgagattaaactgctccagcatttccgcggtcat
cgcaatatcacgtgtttgtatgacatggatatacccagaccagagaatttcaacgagacc
tacctgtacgaaggcaagtgctttttggttgcccagttgatggagtgcgatctggctgca
atcatccggtcgggacagcccttaacagatgctcacttccagtccttcatttaccaaata
ctttgtggattaaaatacatccattccgccaatgtcttgcatcgagatctaaagccgggt
aatttgctagttaatgctgactgcgagctgaaaatttgcgactttggcttggctcgtggc
ttctccatcgatccggatgagaatgctggctatatgactgaatacgttgccacgcgatgg
taccgtgcccctgaaatcatgttaagctttccaagctacaccaaagctattgatgtatgg
tctgttggttgtattctggctgaactcctaggtggccggcctttcttcaaaggccgtgat
tacgttgaccaacttaatcaaatccttcactaccttggaacacccaatgaagaaaccctc
tcccgcattggctccccgcgagcgcaagaatacgtcaggaatctcccattcatgcacaaa
atccctttccagcgcctctttccgagtgcgaacccggacgctctggaccttctagatcga
atgctggcctttgatccgtcttcccgtatctctgtcgaagaggctcttgaacaccgctac
ctgcatatctggcacgatgcgactgatgagccatcatgccccacgaccttcgacttccac
tttgaggttgttgatgatgtaccagagatgaggaggatgattttggatgaagtcgtccga
ttccgccagcaagtaagacagagttctcagacgcagggtagtgcggctgggcaacaggcg
gctcagcaggctcaacaaaatgttccaatcccggaagatcattctggagtctggaagcag
gaagatccccggccacaggaggctgttcttgatagctctagaaatccgaatgaccttgaa
gcatcactccagagaggaatggacgttgttagatga

DBGET integrated database retrieval system