KEGG   Paracoccidioides lutzii Pb01: PAAG_06948Help
Entry
PAAG_06948        CDS       T02230                                 

Definition
(RefSeq) mitogen-activated protein kinase MKC1
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 428 aa AA seqDB search
MTDLPGRKVFKVFNQEFVVDERYNVTKELGQGAYGIVCAATNIQTGEGVAIKKVTNVFSK
KILAKRALREIKLLQHFRGHRNITCLYDMDIPRPENFNETYLYEGKCFLLMECDLAAIIR
SGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSI
DPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVD
QLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMHKIPFQRLFPSANPDALDLLDRMLA
FDPSSRISVEEALEHRYLHIWHDATDEPSCPTTFDFHFEVVDDVPEMRRMILDEVVRFRQ
QVRQSSQTQGSAAGQQAAQQAQQNVPIPEDHSGVWKQEDPRPQEAVLDSSRNPNDLEASL
QRGMDVVR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttaccaggacgcaaggtatttaaggtgttcaaccaagagtttgtggttgat
gagcgatacaacgtgacaaaggagttgggacagggcgcgtatggtattgtctgtgccgcc
acgaacatccaaaccggggaaggtgttgcaatcaagaaagtgacaaacgtgttcagtaag
aaaatcttggcaaagcgcgcactgcgtgagattaaactgctccagcatttccgcggtcat
cgcaatatcacgtgtttgtatgacatggatatacccagaccagagaatttcaacgagacc
tacctgtacgaaggcaagtgctttttgttgatggagtgcgatctggctgcaatcatccgg
tcgggacagcccttaacagatgctcacttccagtccttcatttaccaaatactttgtgga
ttaaaatacatccattccgccaatgtcttgcatcgagatctaaagccgggtaatttgcta
gttaatgctgactgcgagctgaaaatttgcgactttggcttggctcgtggcttctccatc
gatccggatgagaatgctggctatatgactgaatacgttgccacgcgatggtaccgtgcc
cctgaaatcatgttaagctttccaagctacaccaaagctattgatgtatggtctgttggt
tgtattctggctgaactcctaggtggccggcctttcttcaaaggccgtgattacgttgac
caacttaatcaaatccttcactaccttggaacacccaatgaagaaaccctctcccgcatt
ggctccccgcgagcgcaagaatacgtcaggaatctcccattcatgcacaaaatccctttc
cagcgcctctttccgagtgcgaacccggacgctctggaccttctagatcgaatgctggcc
tttgatccgtcttcccgtatctctgtcgaagaggctcttgaacaccgctacctgcatatc
tggcacgatgcgactgatgagccatcatgccccacgaccttcgacttccactttgaggtt
gttgatgatgtaccagagatgaggaggatgattttggatgaagtcgtccgattccgccag
caagtaagacagagttctcagacgcagggtagtgcggctgggcaacaggcggctcagcag
gctcaacaaaatgttccaatcccggaagatcattctggagtctggaagcaggaagatccc
cggccacaggaggctgttcttgatagctctagaaatccgaatgaccttgaagcatcactc
cagagaggaatggacgttgttagatga

DBGET integrated database retrieval system