KEGG   Paracoccidioides lutzii Pb01: PAAG_06951Help
Entry
PAAG_06951        CDS       T02230                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00630  Glyoxylate and dicarboxylate metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01200  Carbon metabolism
Module
pbl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAAG_06951
Enzymes [BR:pbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PAAG_06951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 9094314
NCBI-ProteinID: XP_002791040
UniProt: C1H8F5
Position
Unknown
AA seq 537 aa AA seqDB search
MDSIEQEDQKYWAEVQAVKEWWQDSRWRYTKRPFTAEQIVAKRGNLKIEYPSNVQSKKLW
GILEERFKNKTASFTYGCLEPTMLTQMVKYLDTVYVSGWQSSSTASSTDEPSPDLADYPM
NTVPNKVNQLWMAQLFHDRKQREERLRAPKSQRASLPNIDYLRPIIADADTGHGGLTAVM
KLTKLFIERGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQADIMGTDLLA
VARTDSEAATLITSTIDPRDHAFIIGSTNPNIKPLNDLMIVAEQAGKNGADLQAIEDKWN
AEAGLKLFSEAVVDQIKASSIPNKQAVIDGFLRDVKGKSNTEARAIAKKITGSDIYFDWD
AARTREGFYRYRGGTQCAVNRAIAYAPFADLIWMESKLPDYAQAKEFAEGVHAVWPEQKL
AYNLSPSFNWKAAMPRGEQETYIRRLGKLGYAWQFITLAGLHTTALISDQFAKAYSMNGM
RAYGELVQEPEMENGVDVVTHQKWSGANYVDELLKMVSGGISSTSAMGKGVTEDQFK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggattctatcgagcaagaagatcagaaatactgggctgaagtccaggccgtcaaagaa
tggtggcaggactcaagatggcggtataccaagcgtccgttcaccgcagagcagatcgtt
gcgaagcggggaaacttgaagattgaatatccatcaaatgtccagagcaaaaagctttgg
gggattctggaagagcgtttcaagaacaaaactgccagcttcacttatggctgtctcgaa
cccacaatgctcacccagatggtcaaatatctcgatacggtctacgtctctggctggcag
agctcttctacagcatcgtcaactgacgagccctctccagaccttgcagattacccaatg
aacactgtccccaataaggtcaaccagctatggatggcacagctcttccatgaccgcaaa
cagcgcgaggaaagattgagggctcctaagtcccaacgcgcctcgcttcccaacatcgat
tacttgaggccaattattgcggatgcggatactggtcatggtggattgaccgctgtcatg
aagctgaccaaattgttcatcgagcgaggagctgctggcattcatattgaggatcaagcc
cctggaacgaagaagtgcggccatatggctggcaaggtcttagtccccatcagcgagcat
atcaacagacttgttgccatccgagcccaggctgatattatgggaaccgacctcctggct
gttgctagaactgattccgaagcggcaaccctcatcacatcaactattgatccccgggac
catgctttcattattggctcaacaaatcctaatatcaaacctctcaacgatctgatgatt
gttgctgagcaagcaggcaagaacggagcagatctccaggcaattgaggacaagtggaat
gctgaggcgggcctaaagcttttctccgaggcagttgttgaccaaatcaaggcatcttct
attcccaacaagcaggctgttatcgatggattcctccgcgacgtcaagggcaagagcaat
actgaagcccgtgcaatcgccaagaagatcaccggttcagatatctattttgactgggat
gctgctagaactcgggagggcttctaccgctaccgtggcggtacccagtgtgccgtcaac
cgtgccattgcctacgccccatttgccgatcttatctggatggagagcaaattgcccgac
tatgcccaggcaaaggagtttgctgaaggagtccacgctgtgtggcctgaacagaagctc
gcttacaacctttccccatccttcaactggaaggccgccatgccacgtggcgagcaggag
acctacatccgccgtctgggcaagctgggttacgcctggcaattcatcacccttgccggt
ctccacaccactgcccttatctctgaccagtttgccaaggcctactccatgaatggcatg
cgcgcctatggcgaactagtccaggagcccgagatggagaatggagttgatgtcgttacc
caccagaaatggagtggtgccaactatgtcgacgagctgttgaagatggtcagtggcggt
atcagcagcaccagcgccatgggtaaaggagtcactgaagatcaattcaaatag

DBGET integrated database retrieval system