KEGG   Paracoccidioides brasiliensis: PAAG_07056Help
Entry
PAAG_07056        CDS       T02230                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAAG_07056
Transcription machinery [BR:pbl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PAAG_07056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 393 aa AA seqDB search
MAPISVDRGKRKASEERPPEDTTAHRSKKARTESPKKEDQDDDKHALKLVPYPEKPAVLE
ERSGQIEFRVVNNDGERESFIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKHP
LEVVGGITYRPFKGRKFAEIVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYAIGYFKKQ
GFTKDITLEKSIWMGYIKDYEGGTIMQCTMLPKIRYLEAGRMLLKQKEAVQAKIRAFSKS
HIVHAPPKEWKNGAFNIDPLSIPAIKESGWSPDMDELARQPRHGPNYNQLLHLLNDMQNH
TSAWPFAQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFIKDAKLIFDNCRRY
NNENTSYAKSANKLERFMWQQIRNIPEWSHLAE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaatttctgttgaccgtggcaagcggaaggcttctgaagagcggccaccggag
gatactactgctcaccgaagcaaaaaggcgagaacggagtctcctaagaaagaagaccag
gacgatgacaagcacgctctcaaactagtaccttaccctgagaagcctgcggttttagag
gaacgatctgggcaaattgaatttcgggttgtcaacaatgatggcgagagggagagcttt
atcattctcacaggtctcaaatgcatttttcagaagcagctgccaaaaatgcctaaagat
tatatcgccagactggtgtatgatagaactcacctgtccatcgccattgtaaaacatccg
ttagaagtagttggtggcataacgtatcgaccttttaaaggaaggaagttcgcagagatt
gtgaaaggatatggagcccatttaatgtctcatttaaaggactatgtgaaagccacttct
gatgtgatgcattttcttacatatgctgataattatgctattggatatttcaaaaagcaa
ggattcacgaaagatatcacacttgaaaagtctatttggatgggctacatcaaggactac
gagggaggcacgattatgcaatgcacaatgctcccgaagattcgatatctcgaggctgga
cggatgctcttaaagcagaaggaagcagtacaagccaaaatccgagcttttagcaaatcg
cacattgtccatgcgccacctaaggagtggaagaacggtgctttcaacatcgaccccctg
agtatacctgcaattaaagaatctggatggtcaccagatatggatgagttggcccgccaa
ccccgacatggtcctaattataaccaactgctacacctactcaacgacatgcagaaccat
acctctgcttggccatttgctcaaccggttaacagagatgaagtccctgactactacgaa
gttatcaaggagcctatggatctttccacaatggaggagaaacacgaaaaggacatgtat
ccgaccccgcaagacttcatcaaggatgccaaattaatttttgacaattgtcggaggtat
aataatgaaaatacctcatatgctaaaagcgcaaataaattggaacgatttatgtggcaa
cagatcagaaatataccagagtggtcgcacctggcggagtaa

DBGET integrated database retrieval system