KEGG   Paracoccidioides lutzii Pb01: PAAG_07056Help
Entry
PAAG_07056        CDS       T02230                                 

Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PAAG_07056
Transcription machinery [BR:pbl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PAAG_07056
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    PAAG_07056
   HAT complexes
    PCAF complex
     PAAG_07056
    STAGA complex
     PAAG_07056
    TFTC complex
     PAAG_07056
    SAGA complex
     PAAG_07056
    SLIK complex
     PAAG_07056
    ADA-HAT complex
     PAAG_07056
    HAT-A2 complex
     PAAG_07056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 393 aa AA seqDB search
MAPISVDRGKRKASEERPPEDTTAHRSKKARTESPKKEDQDDDKHALKLVPYPEKPAVLE
ERSGQIEFRVVNNDGERESFIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKHP
LEVVGGITYRPFKGRKFAEIVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYAIGYFKKQ
GFTKDITLEKSIWMGYIKDYEGGTIMQCTMLPKIRYLEAGRMLLKQKEAVQAKIRAFSKS
HIVHAPPKEWKNGAFNIDPLSIPAIKESGWSPDMDELARQPRHGPNYNQLLHLLNDMQNH
TSAWPFAQPVNRDEVPDYYEVIKEPMDLSTMEEKHEKDMYPTPQDFIKDAKLIFDNCRRY
NNENTSYAKSANKLERFMWQQIRNIPEWSHLAE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaatttctgttgaccgtggcaagcggaaggcttctgaagagcggccaccggag
gatactactgctcaccgaagcaaaaaggcgagaacggagtctcctaagaaagaagaccag
gacgatgacaagcacgctctcaaactagtaccttaccctgagaagcctgcggttttagag
gaacgatctgggcaaattgaatttcgggttgtcaacaatgatggcgagagggagagcttt
atcattctcacaggtctcaaatgcatttttcagaagcagctgccaaaaatgcctaaagat
tatatcgccagactggtgtatgatagaactcacctgtccatcgccattgtaaaacatccg
ttagaagtagttggtggcataacgtatcgaccttttaaaggaaggaagttcgcagagatt
gtgaaaggatatggagcccatttaatgtctcatttaaaggactatgtgaaagccacttct
gatgtgatgcattttcttacatatgctgataattatgctattggatatttcaaaaagcaa
ggattcacgaaagatatcacacttgaaaagtctatttggatgggctacatcaaggactac
gagggaggcacgattatgcaatgcacaatgctcccgaagattcgatatctcgaggctgga
cggatgctcttaaagcagaaggaagcagtacaagccaaaatccgagcttttagcaaatcg
cacattgtccatgcgccacctaaggagtggaagaacggtgctttcaacatcgaccccctg
agtatacctgcaattaaagaatctggatggtcaccagatatggatgagttggcccgccaa
ccccgacatggtcctaattataaccaactgctacacctactcaacgacatgcagaaccat
acctctgcttggccatttgctcaaccggttaacagagatgaagtccctgactactacgaa
gttatcaaggagcctatggatctttccacaatggaggagaaacacgaaaaggacatgtat
ccgaccccgcaagacttcatcaaggatgccaaattaatttttgacaattgtcggaggtat
aataatgaaaatacctcatatgctaaaagcgcaaataaattggaacgatttatgtggcaa
cagatcagaaatataccagagtggtcgcacctggcggagtaa

DBGET integrated database retrieval system