KEGG   Paracoccidioides brasiliensis: PAAG_07466Help
Entry
PAAG_07466        CDS       T02230                                 

Definition
WD repeat-containing protein mip1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
pbl  Paracoccidioides brasiliensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1417 aa AA seqDB search
MAQGAGGSQRGPGKSVRVTFGPQVDEYIPSSNNTSTPLSASESDRQRPQKSDGDQLQSNG
RSNCASNGAQAPSGSDGGAVSWRNPVSPSLRAPRKIRPTPALVRAKSEHYTPPGVENGAA
HDGDEDFQLRHGWHEDYTSGDYLKSLTSTFFMYFTEKRHETGGIPKDPAGSWPSQDWRMR
DRLKTVSAALAICLNIGVDPPDIVKTNPTAKLECWVDPTSTTTGAQNKVMEQIGKKLQEQ
YETLSLRTRYKQYLDPAVEETKKFCISLRRNAKDERVLFHYNGHGVPLPTQSGELWVFNK
NYTQYIPISLYDLQTWLAGPSLFVFDVSHAGNIVHNFSTFVEKHEKENIEIRKRDPNAAI
QNYGDCILLAACERTETLPTNPDLPADLFTCCLTTPIEIALRFFVLQNPLHTNISIDEFR
VPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRPLFKKLFRQDLMVAALFRNFLLAERIM
RAHECHPVSSPKLPETHNHPLWQSWDLAIEMVLAQLPALIEHEEGKRHYEYQHSSFFAEQ
LTAFEVYLASGPTEKNPPDQLPIVLQVLLSQAHRLRALIQLSKFLDLGPWAVHLALSIGI
FPYVVKLLQSTAQELKPVMVFIWARIMAVDHTVQNDLLKDNGIHYFITILNPASPIPIEN
ASEHRAMCAFIVAIFCKNYPQGQNVCLAPELFEACLTHLMDAENPLLRQWSCLCLSMLWL
DFPEAKWVGIRCSAPPRLCELALDPVPEVRAAMLYALTSFIGIPDLTDQVAQIEESIALT
VMPMGSDGSVLVRKELLVFLSTFVKRYQNKFLVVAYEQMLEERHFLSHQTPTNKNDQPAP
FQYENRVSHDTVFGTIWKLVLMLSVDPHPEVAQDGDTIVDYIHKSLLESPMRGLAQAAKD
DILKLHGRVQVGKLRHVELDDLNGTGQRTPQAPSNMTSKSEGYLSLGLRKTASVAASWKN
LAFGLSSTAGRPASPMKPLAMTSRVPITPRGRAPAEWTRPPEVNDQPVTSGSYRKARIPL
SRGFRPRDVKTGPVIPLKSDFLDWSTEYFREPQMKPNESDEPGSADYNERLWRRGRNEKI
IAETQPLKEKAGTSKWDISTSLLNNQTQPVKMCFHQFEDYVAVADDRDTVCIWDWQSHSR
LSRFSNGNPIGSKINEIRFINEDDQALLMTGSSDGVLKLFRKYESESDVEIVTAFRALPD
LVPSNRNAGLVLDWQQGQGKALIAGDIKVIRVWNAATEIFSNDISARSGSCITSLTSDQV
AGHIFVAGFGDGAVRVFDQRLKPTTAMVKVWREHKQWITNTHIQRGGVRELISGSRNGEV
RLWDLRMDSSIGTIRATKDTLRTLSVHEHAPVFAIGTNRHEVKTFNTDGTYLSTYEPHGS
FLHPNRSSPIVNAAFHPHRAILACAALNDNHINFVSC
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaggtgcaggaggctcccaacgtggtccgggcaaatcagtccgggtcactttc
ggtccgcaggtcgacgagtatataccttcctcaaacaatacttcaacccccctttctgct
tctgaatccgaccgccagcgaccccaaaagagcgacggcgatcagctccaaagcaatgga
cgctcaaattgcgcatcgaatggtgcgcaggcaccttctggtagcgacggtggagcggtg
tcctggcggaatccagtgtctccatcactccgggcacctaggaagatacgccctacgcca
gctcttgttcgggcaaagagcgaacactacacaccgcctggcgttgagaacggagcagcc
catgacggggatgaggatttccagttaagacacggctggcatgaagattacacttctgga
gactacttgaagagcctcacttccaccttcttcatgtatttcacggagaaacgccatgaa
accggtgggataccgaaagacccagctgggagctggcctagccaggactggcgcatgagg
gataggctgaaaactgtctctgccgcgctagctatctgcctaaatattggtgttgacccc
ccggatatcgtgaagacgaatcctaccgcgaaactggaatgttgggtggacccaacgtct
accactacaggcgcgcagaacaaggtgatggagcaaattggaaagaaactacaagaacag
tatgaaaccctcagtcttcgtacgcgttacaagcaatacctggaccctgccgttgaggag
acgaagaaattctgtatttctcttcgccgtaacgcaaaagacgagcgggtgctctttcac
tacaacggacatggtgtccccctcccaactcagtcgggagaactttgggtatttaataag
aattatacccagtatatcccgatatccttatacgatcttcagacttggcttgctgggcca
agcttgtttgtgtttgatgtgtcccatgctggcaacattgtccacaacttctcaacattt
gtagaaaagcatgagaaggagaacatcgaaattcgcaagagggatccaaatgccgcgatc
caaaactacggcgattgtattttactcgccgcctgtgagagaacagaaacacttccaacc
aatccggatctccccgcagaccttttcacatgctgcttaacgaccccaatcgaaatagca
ttgaggttctttgttctgcaaaatcctcttcacaccaacatatccatcgatgagttcagg
gtaccaggccgcctccaagatcgaagaagtcctctcggtgaattaaattggatattcact
gcgatcactgatacgatcgcctggaataccctgcccagaccgttattcaagaaactgttt
cgacaggacctcatggttgcggctttgtttaggaattttctccttgctgaacggatcatg
agagcccatgaatgccacccagtatcatctcccaaactacccgaaactcacaatcatcca
ttatggcaaagctgggatcttgccattgagatggtccttgctcaactcccggcgctcatt
gagcatgaggaaggcaagcgtcactatgaataccaacattcgtcattctttgccgagcaa
cttactgcgtttgaagtttaccttgcatcaggaccaacggagaagaacccaccagaccaa
cttccaattgtattgcaagtcttgttgagccaggctcatcgcttacgcgcattaattcaa
ctcagcaagtttttggatttggggccgtgggctgttcatttggctctgagcattggtata
ttcccgtatgttgtcaaacttctgcagagtactgcccaagaacttaagcctgtcatggtt
tttatctgggctaggataatggccgtcgaccatacagtgcagaatgacctgctaaaggat
aatggaattcactatttcattacaatcttaaatcccgcttcgcctattcctatagagaac
gcaagtgaacatcgtgccatgtgtgccttcatcgttgcgatattctgcaaaaactaccct
caaggccaaaacgtttgccttgctcccgagctctttgaagcttgtctaactcacttgatg
gatgctgaaaaccctcttctacgccaatggtcttgcctctgcttaagtatgctctggctc
gacttccctgaggcgaaatgggttggtattcggtgctctgcacctccgaggctctgcgaa
ctcgccttagaccccgttccagaagtacgcgcagcgatgctgtatgcgttaaccagtttc
attggtatccccgatttgactgaccaggtagctcagattgaagaatctattgctctcact
gtcatgcccatgggttctgatggcagcgtcctagtaaggaaagaactattggttttcctg
tcgaccttcgtgaagagataccaaaacaagttcctcgtcgttgcatatgaacagatgctt
gaagaacgacattttctttcacatcaaacgcccactaacaaaaatgatcaaccggctccg
ttccagtatgagaacagagtatctcatgacactgtgtttgggacaatatggaaacttgtt
ctcatgctttctgtcgacccacatccggaggtcgcacaagatggagacaccattgttgat
tatattcacaaatctctattggagtctccaatgagaggattagctcaggcagccaaagac
gatatcctgaagctacacggtcgagttcaagtcggtaaacttaggcacgtggaactggat
gatttgaatggaacggggcagaggacaccacaggctccgtctaacatgacatcaaaatct
gagggatacttgtcgctgggtttgagaaaaacagccagcgtagctgcgtcctggaaaaat
cttgccttcggcttatcaagtaccgctggtcgacctgcatcgccaatgaaaccccttgcg
atgacaagccgcgtccccattacaccacggggtcgggcacctgctgagtggactcgaccg
cctgaagtgaatgatcagccagtgacgtcgggatcgtaccgtaaagcacgtataccgctc
tctcgtggctttcggccaagagatgtcaaaactggccctgtcattcctttgaaaagcgat
tttttggactggtcaactgaatactttcgcgagccgcaaatgaaaccgaatgaatcagat
gaacctggcagcgcagattacaacgaacgcctctggcgacgcggcagaaatgagaaaatc
atagctgaaactcagccgcttaaagagaaagcaggaaccagcaagtgggatatttctacc
tcacttctaaacaatcagactcaaccggtcaagatgtgttttcatcaatttgaggactac
gttgcggtagctgatgatagagatactgtttgtatctgggattggcaaagccattcgcgt
ctcagccgtttttctaatggcaacccgataggatcgaaaattaacgaaattcgattcatc
aacgaagacgaccaagcacttctgatgacaggctcctcagatggtgttttgaaactattc
cgcaagtacgaatcggaatcggatgttgagattgtaacagccttccgtgctctgcccgat
ttggtccccagcaacagaaatgcgggactggttttggactggcagcagggccaagggaag
gcactcattgctggcgatatcaaggttattcgcgtctggaacgcggcaactgaaattttc
agcaacgacatatctgctcgttcgggttcctgcataacctctttgacatcagatcaagtc
gcaggacatattttcgtcgctggatttggtgatggcgccgttagagtatttgatcaacgc
ctaaaaccgacaacagcgatggtaaaagtatggcgagagcataaacagtggatcacaaat
acccatatccagcgcggcggagtccgagaattgatatctggtagccgaaatggtgaggtt
cgactttgggatttgcggatggattcatcgataggtaccatccgcgccaccaaagacacc
ttgcggacgttgtctgtgcacgaacacgctccagtattcgcgattggcaccaatcgccat
gaggttaaaactttcaataccgatggcacttatctctccacctacgagcctcatggtagt
tttctacacccaaaccgatcctcaccgatcgtaaacgccgccttccacccacacagggcc
atccttgcctgtgcagctctgaacgataaccatatcaattttgtatcatgctaa

DBGET integrated database retrieval system