KEGG   Paracoccidioides lutzii Pb01: PAAG_07466Help
Entry
PAAG_07466        CDS       T02230                                 

Definition
(RefSeq) WD repeat-containing protein mip1
  KO
K07204  
regulatory associated protein of mTOR
Organism
pbl  Paracoccidioides lutzii Pb01
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 1436 aa AA seqDB search
MIDPNFNLDRTAQAQRYPNMAQGAGGSQRGPGKSVRVTFGPQVDEYIPSSNNTSTPLSAS
ESDRQRPQKSDGDQLQSNGRSNCASNGAQAPSGSDGGAVSWRNPVSPSLRAPRKIRPTPA
LVRAKSEHYTPPGVENGAAHDGDEDFQLRHGWHEDYTSGDYLKSLTSTFFMYFTEKRHET
GGIPKDPAGSWPSQDWRMRDRLKTVSAALAICLNIGVDPPDIVKTNPTAKLECWVDPTST
TTGAQNKVMEQIGKKLQEQYETLSLRTRYKQYLDPAVEETKKFCISLRRNAKDERVLFHY
NGHGVPLPTQSGELWVFNKNYTQYIPISLYDLQTWLAGPSLFVFDVSHAGNIVHNFSTFV
EKHEKENIEIRKRDPNAAIQNYGDCILLAACERTETLPTNPDLPADLFTCCLTTPIEIAL
RFFVLQNPLHTNISIDEFRVPGRLQDRRSPLGELNWIFTAITDTIAWNTLPRPLFKKLFR
QDLMVAALFRNFLLAERIMRAHECHPVSSPKLPETHNHPLWQSWDLAIEMVLAQLPALIE
HEEGKRHYEYQHSSFFAEQLTAFEVYLASGPTEKNPPDQLPIVLQVLLSQAHRLRALIQL
SKFLDLGPWAVHLALSIGIFPYVVKLLQSTAQELKPVMVFIWARIMAVDHTVQNDLLKDN
GIHYFITILNPASPIPIENASEHRAMCAFIVAIFCKNYPQGQNVCLAPELFEACLTHLMD
AENPLLRQWSCLCLSMLWLDFPEAKWVGIRCSAPPRLCELALDPVPEVRAAMLYALTSFI
GIPDLTDQVAQIEESIALTVMPMGSDGSVLVRKELLVFLSTFVKRYQNKFLVVAYEQMLE
ERHFLSHQTPTNKNDQPAPFQYENRVSHDTVFGTIWKLVLMLSVDPHPEVAQDGDTIVDY
IHKSLLESPMRGLAQAAKDDILKLHGRVQVGKLRHVELDDLNGTGQRTPQAPSNMTSKSE
GYLSLGLRKTASVAASWKNLAFGLSSTAGRPASPMKPLAMTSRVPITPRGRAPAEWTRPP
EVNDQPVTSGSYRKARIPLSRGFRPRDVKTGPVIPLKSDFLDWSTEYFREPQMKPNESDE
PGSADYNERLWRRGRNEKIIAETQPLKEKAGTSKWDISTSLLNNQTQPVKMCFHQFEDYV
AVADDRDTVCIWDWQSHSRLSRFSNGNPIGSKINEIRFINEDDQALLMTGSSDGVLKLFR
KYESESDVEIVTAFRALPDLVPSNRNAGLVLDWQQGQGKALIAGDIKVIRVWNAATEIFS
NDISARSGSCITSLTSDQVAGHIFVAGFGDGAVRVFDQRLKPTTAMVKVWREHKQWITNT
HIQRGGVRELISGSRNGEVRLWDLRMDSSIGTIRATKDTLRTLSVHEHAPVFAIGTNRHE
VKTFNTDGTYLSTYEPHGSFLHPNRSSPIVNAAFHPHRAILACAALNDNHINFVSC
NT seq 4311 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccccaactttaacctggatcgaaccgcgcaagcccagcggtatcccaacatg
gcgcaaggtgcaggaggctcccaacgtggtccgggcaaatcagtccgggtcactttcggt
ccgcaggtcgacgagtatataccttcctcaaacaatacttcaacccccctttctgcttct
gaatccgaccgccagcgaccccaaaagagcgacggcgatcagctccaaagcaatggacgc
tcaaattgcgcatcgaatggtgcgcaggcaccttctggtagcgacggtggagcggtgtcc
tggcggaatccagtgtctccatcactccgggcacctaggaagatacgccctacgccagct
cttgttcgggcaaagagcgaacactacacaccgcctggcgttgagaacggagcagcccat
gacggggatgaggatttccagttaagacacggctggcatgaagattacacttctggagac
tacttgaagagcctcacttccaccttcttcatgtatttcacggagaaacgccatgaaacc
ggtgggataccgaaagacccagctgggagctggcctagccaggactggcgcatgagggat
aggctgaaaactgtctctgccgcgctagctatctgcctaaatattggtgttgaccccccg
gatatcgtgaagacgaatcctaccgcgaaactggaatgttgggtggacccaacgtctacc
actacaggcgcgcagaacaaggtgatggagcaaattggaaagaaactacaagaacagtat
gaaaccctcagtcttcgtacgcgttacaagcaatacctggaccctgccgttgaggagacg
aagaaattctgtatttctcttcgccgtaacgcaaaagacgagcgggtgctctttcactac
aacggacatggtgtccccctcccaactcagtcgggagaactttgggtatttaataagaat
tatacccagtatatcccgatatccttatacgatcttcagacttggcttgctgggccaagc
ttgtttgtgtttgatgtgtcccatgctggcaacattgtccacaacttctcaacatttgta
gaaaagcatgagaaggagaacatcgaaattcgcaagagggatccaaatgccgcgatccaa
aactacggcgattgtattttactcgccgcctgtgagagaacagaaacacttccaaccaat
ccggatctccccgcagaccttttcacatgctgcttaacgaccccaatcgaaatagcattg
aggttctttgttctgcaaaatcctcttcacaccaacatatccatcgatgagttcagggta
ccaggccgcctccaagatcgaagaagtcctctcggtgaattaaattggatattcactgcg
atcactgatacgatcgcctggaataccctgcccagaccgttattcaagaaactgtttcga
caggacctcatggttgcggctttgtttaggaattttctccttgctgaacggatcatgaga
gcccatgaatgccacccagtatcatctcccaaactacccgaaactcacaatcatccatta
tggcaaagctgggatcttgccattgagatggtccttgctcaactcccggcgctcattgag
catgaggaaggcaagcgtcactatgaataccaacattcgtcattctttgccgagcaactt
actgcgtttgaagtttaccttgcatcaggaccaacggagaagaacccaccagaccaactt
ccaattgtattgcaagtcttgttgagccaggctcatcgcttacgcgcattaattcaactc
agcaagtttttggatttggggccgtgggctgttcatttggctctgagcattggtatattc
ccgtatgttgtcaaacttctgcagagtactgcccaagaacttaagcctgtcatggttttt
atctgggctaggataatggccgtcgaccatacagtgcagaatgacctgctaaaggataat
ggaattcactatttcattacaatcttaaatcccgcttcgcctattcctatagagaacgca
agtgaacatcgtgccatgtgtgccttcatcgttgcgatattctgcaaaaactaccctcaa
ggccaaaacgtttgccttgctcccgagctctttgaagcttgtctaactcacttgatggat
gctgaaaaccctcttctacgccaatggtcttgcctctgcttaagtatgctctggctcgac
ttccctgaggcgaaatgggttggtattcggtgctctgcacctccgaggctctgcgaactc
gccttagaccccgttccagaagtacgcgcagcgatgctgtatgcgttaaccagtttcatt
ggtatccccgatttgactgaccaggtagctcagattgaagaatctattgctctcactgtc
atgcccatgggttctgatggcagcgtcctagtaaggaaagaactattggttttcctgtcg
accttcgtgaagagataccaaaacaagttcctcgtcgttgcatatgaacagatgcttgaa
gaacgacattttctttcacatcaaacgcccactaacaaaaatgatcaaccggctccgttc
cagtatgagaacagagtatctcatgacactgtgtttgggacaatatggaaacttgttctc
atgctttctgtcgacccacatccggaggtcgcacaagatggagacaccattgttgattat
attcacaaatctctattggagtctccaatgagaggattagctcaggcagccaaagacgat
atcctgaagctacacggtcgagttcaagtcggtaaacttaggcacgtggaactggatgat
ttgaatggaacggggcagaggacaccacaggctccgtctaacatgacatcaaaatctgag
ggatacttgtcgctgggtttgagaaaaacagccagcgtagctgcgtcctggaaaaatctt
gccttcggcttatcaagtaccgctggtcgacctgcatcgccaatgaaaccccttgcgatg
acaagccgcgtccccattacaccacggggtcgggcacctgctgagtggactcgaccgcct
gaagtgaatgatcagccagtgacgtcgggatcgtaccgtaaagcacgtataccgctctct
cgtggctttcggccaagagatgtcaaaactggccctgtcattcctttgaaaagcgatttt
ttggactggtcaactgaatactttcgcgagccgcaaatgaaaccgaatgaatcagatgaa
cctggcagcgcagattacaacgaacgcctctggcgacgcggcagaaatgagaaaatcata
gctgaaactcagccgcttaaagagaaagcaggaaccagcaagtgggatatttctacctca
cttctaaacaatcagactcaaccggtcaagatgtgttttcatcaatttgaggactacgtt
gcggtagctgatgatagagatactgtttgtatctgggattggcaaagccattcgcgtctc
agccgtttttctaatggcaacccgataggatcgaaaattaacgaaattcgattcatcaac
gaagacgaccaagcacttctgatgacaggctcctcagatggtgttttgaaactattccgc
aagtacgaatcggaatcggatgttgagattgtaacagccttccgtgctctgcccgatttg
gtccccagcaacagaaatgcgggactggttttggactggcagcagggccaagggaaggca
ctcattgctggcgatatcaaggttattcgcgtctggaacgcggcaactgaaattttcagc
aacgacatatctgctcgttcgggttcctgcataacctctttgacatcagatcaagtcgca
ggacatattttcgtcgctggatttggtgatggcgccgttagagtatttgatcaacgccta
aaaccgacaacagcgatggtaaaagtatggcgagagcataaacagtggatcacaaatacc
catatccagcgcggcggagtccgagaattgatatctggtagccgaaatggtgaggttcga
ctttgggatttgcggatggattcatcgataggtaccatccgcgccaccaaagacaccttg
cggacgttgtctgtgcacgaacacgctccagtattcgcgattggcaccaatcgccatgag
gttaaaactttcaataccgatggcacttatctctccacctacgagcctcatggtagtttt
ctacacccaaaccgatcctcaccgatcgtaaacgccgccttccacccacacagggccatc
cttgcctgtgcagctctgaacgataaccatatcaattttgtatcatgctaa

DBGET integrated database retrieval system