KEGG   Paracoccidioides brasiliensis: PAAG_07563Help
Entry
PAAG_07563        CDS       T02230                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAAG_07563
Enzymes [BR:pbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PAAG_07563
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C44
   PAAG_07563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 578 aa AA seqDB search
MCGIFVCHCHPDVQKFKPVALRMAKAVRHRGPDWSGNFIANNTILTHERLSIIGLDSGSQ
PLVNDDGTVALAVNGEIYNHRILRKSLKTSYNFKTQSDCEVIIPLYMEHDVDTPKFLDGM
FSWVLFDKKENRVIAARDPIGITSFYQGWSSQTPGAVYFASELKSLHPVCDKIISFPPGH
VYDSKTDTMKRYFEPTWWDPTNVPTAPVDYKLIRETLEKSVRKRLMAEVPFGVLLSGGLD
SSLVASIAQRETLRQQQFATSGSGENGYVNRVASSSGLVGIDDSNELSTITKLPQLHSFS
IGLPDSPDTKAALEVAKFLGTKHHAFTFTLEDGLSALSDVIYHLETYDVTTIRASTPMYL
LSRKIKGLGVKMVLSGEGSDEIFGGYLYFHAAPSKEAFHEETVSRVKHLHLADCLRANKS
TSAWGVEARVPFLDKQFLEVSMGIDPQEKMITKDRIEKYILRKAFDTSDEGPDAKPYLPD
SILWRQKEQFSDGVGYGWIDALKDNAELHVTDEMMKNPKPEWGDEVPDTKEGFWYRMMFD
EHFPQYCASTVMRWTPKWSKQTDPSGRAISIHIAKYES
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattttcgtgtgtcattgtcatccagatgtgcagaagttcaagccggtagct
ttgcgcatggcgaaagctgtgcgccatcgcggccctgattggagtggaaactttattgcg
aacaacaccatccttacacatgagcggttgagcattattggcctcgattctggctcccag
ccccttgttaatgatgatggaaccgtcgctctcgcggtcaacggcgaaatttataaccac
agaatcttgcgaaagagtctgaaaacttcatataacttcaagacgcagtcggattgcgaa
gttatcatccccttgtacatggagcatgacgtcgacacccctaaattcctcgacggcatg
ttttcatgggtcctcttcgacaagaaggagaacagagttatcgctgcccgagacccaatc
ggcatcacgagcttttaccagggatggtcatctcaaacacctggcgcggtctatttcgcc
tctgaactaaagtcgttgcaccccgtctgcgacaagatcatatccttcccaccaggccac
gtatatgattcgaaaacagacactatgaaacgttacttcgagcctacatggtgggatcca
accaacgtcccaacggcccccgttgactataaacttatccgtgaaacgttggagaaatcc
gtgcgcaaacggttgatggcggaggttccatttggtgtcctgctttctgggggcctggac
tcgagtttagtggcctccattgcgcagcgggaaacgctgcggcaacagcaatttgctact
tcaggcagcggtgagaacggatatgtcaaccgggtagcgtccagctcgggactggtgggc
attgacgattctaacgaactgtccacgatcacgaaactgccacagcttcattcgttttct
attggtctccccgactcccccgacaccaaggcggcgcttgaagtggccaagttcctcgga
acgaagcatcatgcctttacctttacgctagaagatggcctcagcgccctctcggatgtc
atctaccacctggaaacgtacgatgtgaccaccatccgcgcatcgacacccatgtacctg
ctcagcagaaagattaaggggctaggcgtaaagatggtgcttagcggtgagggcagcgat
gagatctttggcgggtacctatatttccatgccgctccaagcaaggaggccttccacgag
gagactgtctcacgtgtaaaacacctgcatctggccgattgcctgcgtgccaacaagtca
acctcagcatggggtgttgaggctcgcgtccctttccttgataagcaattcctcgaagtc
tccatgggcatcgacccacaggagaagatgattacgaaagaccggattgagaaatacatc
ctgcgcaaggcgtttgatacctctgatgaagggccggatgcgaagccgtacctgcctgac
agtatcctgtggaggcagaaggagcagtttagtgatggggttggttatggatggattgat
gctttaaaggataatgcggagttgcatgttacggatgagatgatgaagaatcccaagccg
gagtggggggatgaagtgccggatactaaggaagggttctggtatcgcatgatgttcgac
gagcacttcccgcaatactgcgcgtcgacggtgatgcggtggacgccaaaatggtcgaag
cagacggatcccagtggacgtgcgatttcgatacatattgccaagtacgagagctag

DBGET integrated database retrieval system