KEGG   Paracoccidioides lutzii Pb01: PAAG_07625Help
Entry
PAAG_07625        CDS       T02230                                 

Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase family protein
  KO
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PAAG_07625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 376 aa AA seqDB search
MSNSNTNTNNRFNPRQLFSDAAFQDMHSLVEWVSSLPPAQQFLPPVSPTVYVTLIQWTVP
FHPQGKTSLPSSSLNFPGRYAWLCMESVGAINLLYTLYATPSSFPDGQLPIWHKVVACLY
VLHYLNRAVITPLFLAPSMSPIHLIIILSALGFNYLNSSCLAGWLLGYGTPMLGSTAPQS
HHPSKFSTSYFPVEYLPYIGLCLFFIGMYGNIRAEGVLFRLRREEVDKRDDNSKDKIPTT
PSTFFSSSNNPKNKYDKVYILPPPNGWFRTILFPHYALEWIEWFGFLLIGFSITPSPAPT
SAITPSLALAPYYAPLATILLNKWGLSFPLPAIALFVNSVLTTAARASWGRKWYVERFGE
ESVGRCGAFVPYVKWL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattccaacaccaacacgaacaacagatttaatcccaggcaattgttctcagat
gctgcattccaagacatgcactccctagtagaatgggttagctccctcccaccggctcag
cagttcctcccgcccgtatctccaacagtctatgtaaccctcatacaatggactgttccc
ttccacccacaagggaaaacttccctcccttcctccagccttaactttcccggccgctat
gcctggctctgcatggaaagcgtcggtgccatcaacctcctatacaccctctacgccacc
ccctccagtttcccagacggccagttacccatctggcataaagtagtcgcatgtctctat
gtcctccactatctaaaccgggcggtcataacacccctcttcctcgccccaagcatgtcg
ccaatccacctgatcataatcctttcagcattgggattcaactatctcaactcaagctgt
ctagcaggctggttgttaggttatggaacacccatgcttggttccacggcgccgcaatct
catcatccatcaaagttctccacgtcatatttcccagtggaatatttaccctacatcgga
ctctgcctatttttcataggcatgtacggcaacataagagcagagggagtcctcttccgc
ctacgaagggaagaagtcgacaaacgggatgataattctaaagataaaatccccaccaca
ccatcaacttttttctcatcatctaacaaccccaaaaacaaatacgacaaagtctacatc
ctcccccctccaaacggctggttccgcacaatactattcccacactacgccttggaatgg
attgaatggtttggattcctcctgatcggattctccataacgccctccccagctccaact
tctgccatcactcccagcctagctctcgccccgtattatgctcccctagctaccatcctg
ctaaacaagtggggtctgtctttcccacttcctgcaatcgctctttttgtaaattctgtg
ttaaccacagcggcgcgtgcaagctgggggcggaagtggtatgtggagcgatttggggag
gagagtgtaggcaggtgtggcgcgtttgtgccgtatgtaaagtggttgtga

DBGET integrated database retrieval system