KEGG   Paracoccidioides brasiliensis: PAAG_07722Help
Entry
PAAG_07722        CDS       T02230                                 

Definition
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    PAAG_07722
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    PAAG_07722
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     PAAG_07722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1161 aa AA seqDB search
MAASGWASPSIFKDNTHSQSRSPLHVPRRIPFQNGFSSTLSASAPPTSGFEPSGVSTDSS
SLPTYFSNFPSPTPFSPTGFTDSAHDTAFRNTVNPVMTLGSPVPLELPEGAVAFPSQPFN
ATPLGTDSAAANNTTSSKTPGLMRRISRGAANKLTRRRQSTSRYDKRDNSSGPVIMQRRN
DSKTGTTASKDSGLDSSYEEEEEPCDHLASWCNCDTNGTTSRCSMAVAANDGCVAPKLDS
ILHRGSLLTKVSKHKTKMVTFFLDLQSAKVYWDLSNPAKRLYIDDIKEIRTGLDARNYRE
EHDIPERLEDLWFTIIFTNPEQSKSKPIKTLHLIAPNKETFELWTNTLEGISRYRIGLMA
GLAGSGQSESVLKAHWQREMSRRSLESGEESLDRNAVENLCQSLHINCSKNMLRAQFAKA
DKDRTGRLNFAQFKDFLQRLKDRKDIREIFRSVATDPAQGLTLDEFLEFLRDSQCENVED
NNRNYWSSTFEFLVRGSKQRALEPRNSPSARMNLEAFSAFLMSPKNGIYPARFSSPKLDR
PLNEYFISSSHNTYLLGRQVAGESSTEAYITALQNGCRCVEIDCWDGADGRPTVSHGRTL
TSSVLFADCINVINRYAFQASEYPLILSLEVHCSPIQQLAMVEIMKETFGDKLLLRPLLT
NCPILPCPDDLKHRILIKVKTADEDEQLTSSNSQIAGRKRSSSSPFARANGPESGAFTFP
IAHVTQPIDSGNFTAWTPGRRSLTTTSLSSASEDSDAGPLVMSTRKEKRKQPKSRITREL
AELGVYTRGYKWHSFNSPESKRFNHVYSFSERSFEQMSRDSEIKALLEAHTKSFITRVYP
ANTRFRSSNFDPNFFWRRGVQMVAMNWQTYDIGMQMNQAMFAAGTDQTGYTLKPDSLRTS
PSSPRSLALCGDVKPKVDRKLVRFTVDIISAQQLPRLRGMGPEDSINPYIEIELFCADDK
KKGLAFGEGGVDTSARNGVSGIGQPHRRRTKIEQQNGFNPVFNDQFKLSLETKYPDLVFV
RWVVRNSPDGRSFGGNNSVQLATFTAKLSSLSQGYRYLPLYDGSGDQYLFSTLFCKITKF
DQVPAQRPGFDLSRGDQRGIIKQIKHTLTKRTLSAERDKERDSDRGQDKGKDLILKPEDL
QLRNKGSSFTDGPSLALPSPA
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atggcggctagcgggtgggcctccccctctatcttcaaggacaacactcattcccaatca
agatcccctctacatgttccgcgcagaattcctttccaaaatgggttctcttctacactc
agcgcttctgcccctcctacctccggatttgaaccttcaggggtatcaacagattcatct
agtctcccgacctatttttctaatttccccagccctactcctttttctcctaccggtttc
accgactccgcgcatgatacggcatttcgcaatactgtgaatcctgtaatgacgctcgga
tctcccgttcccctcgaactgccggaaggtgctgtggcctttccttcacaaccctttaat
gctactccacttggtacagatagcgccgccgcaaacaacactacctccagcaaaactcct
gggctgatgcggaggatatccagaggagctgcgaataagctaactcgtcgaagacaatct
acatcccgctatgataagcgagacaatagctctggtcctgtgattatgcagaggagaaat
gacagtaaaactggaacgacagcatctaaggatagtggcttggattcgagctatgaagaa
gaggaagaaccttgcgatcatctagcttcgtggtgtaactgtgatacaaatggtactacc
agtcgatgtagcatggctgttgcagccaatgatggctgtgttgcacccaaactggattct
attttgcatcgcggttcacttctgaccaaggtatctaagcataagacgaagatggtgaca
tttttccttgatttacaatctgccaaggtttactgggacttgtcaaatcccgcaaaacga
ctttatatcgatgatattaaagaaattcgcactggcctagatgcccgcaattatcgggag
gaacatgatatacctgaacgactggaggatttatggttcacaattatttttacgaaccct
gagcagtccaaaagcaagcccattaaaacgctgcatcttatcgctcccaataaagagact
ttcgaactgtggacgaataccctagaaggaatctctagataccggattggtctcatggcc
ggcttggccggctctggtcagagtgagagcgtcctgaaagctcactggcaacgtgaaatg
tctcgacggtctctggagtcaggagaagagtcccttgatcggaatgccgtcgagaacctc
tgccaaagcttacatatcaattgctccaaaaacatgttacgggcccaattcgcaaaagca
gataaggaccgaactggaagattgaatttcgcccaatttaaagatttccttcaacgactg
aaagaccgcaaggatatccgagaaattttccgttctgtcgcaacagatcctgctcagggg
ttaacgttagatgagtttctcgaattccttcgcgattctcagtgcgaaaacgtggaggat
aataacagaaactactggtcttcaaccttcgaatttctcgttcgcggctccaaacaacgt
gccctagaaccacgaaattctcccagtgctcggatgaacttggaagctttttcggccttt
ttaatgtccccgaaaaatggcatatacccagcacgattctcatctccgaagcttgacaga
cccctcaacgaatatttcatctcgagttcgcataacacgtatttactgggaagacaagtt
gccggcgaatccagcaccgaagcctacatcacggccctccaaaatggctgccgctgtgtg
gagattgactgctgggatggcgctgatggtcgcccgaccgtctctcacggccgtacattg
acaagcagcgttttattcgcagactgtattaatgtcatcaacagatatgcattccaagct
tctgagtatccgttgatactctcacttgaggtccattgttccccaattcaacaactggcg
atggtggaaatcatgaaagagacgtttggggataagcttcttcttcgaccgcttttgacg
aattgcccgatattgccctgcccagatgacctaaagcatcgcatcctgataaaagttaaa
accgcagacgaagacgagcagttgacctcttccaactctcagattgctgggcgcaagcgc
agttccagctcgccctttgctcgtgcaaatggtccggaaagcggtgcttttacatttccc
attgcgcatgtaactcagccaatagattctggtaactttacagcatggacacctggaaga
cgatcacttacaacgacaagcttgagtagcgcatccgaggatagtgatgctggccccctt
gtgatgtcgacaaggaaagagaagagaaagcagcctaaaagtcggatcacccgagagctt
gctgaactgggtgtatacactcgtggatacaaatggcacagcttcaactctccagagagc
aaaaggtttaaccatgtgtattctttctccgagagatctttcgaacaaatgtctcgcgac
tcggagatcaaagcacttcttgaagcgcataccaaatctttcatcacacgtgtctatccg
gcgaatactcgtttccgctcatcaaattttgatccgaattttttctggaggagaggcgtg
caaatggtagcaatgaactggcagacgtacgatataggtatgcaaatgaaccaagcaatg
tttgccgccggaaccgatcaaaccggctatactctcaagccagacagtctgcgaacatct
ccgtcgtctccgagatctcttgctctttgtggcgatgtaaagccaaaagtagacaggaaa
ttggttagattcacagtggatatcatatccgcacagcagctcccgagattgcgaggcatg
ggtcctgaagatagcattaatccgtatatcgaaatcgagttgttctgcgccgatgacaag
aagaaaggccttgcatttggcgaagggggtgttgatacttcagcccgcaacggcgtgtct
ggaattggtcaaccgcaccgtcgtcggacaaaaattgaacagcagaatggtttcaaccct
gtgttcaatgaccaattcaaattgtctctagaaaccaaatacccagacctcgtctttgtt
cgttgggtcgtccgcaattctcctgatggacggagctttggtggtaataacagtgtgcag
cttgccaccttcactgcgaagctcagcagtctctcacaaggatacagatatttacctcta
tatgacggaagtggtgatcaatatctattctcaactctcttttgcaaaatcactaaattt
gaccaggtaccagcacaacgccccggtttcgatttatcgagaggagaccagagaggaatt
atcaaacaaattaagcacacattaaccaaacgtacgttgtcggccgagagagacaaggag
agggacagcgatcgcggccaggacaaaggaaaggacttgattctgaaacctgaagacctc
cagcttcgaaataagggatcttccttcactgatggcccttctcttgctcttccatctcca
gcataa

DBGET integrated database retrieval system