KEGG   Paracoccidioides lutzii Pb01: PAAG_07760Help
Entry
PAAG_07760        CDS       T02230                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00260  Glycine, serine and threonine metabolism
pbl00750  Vitamin B6 metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01230  Biosynthesis of amino acids
Module
pbl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAAG_07760
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAAG_07760
Enzymes [BR:pbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAAG_07760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 9093654
NCBI-ProteinID: XP_002790461
UniProt: C1HA31
Position
Unknown
AA seq 536 aa AA seqDB search
MSSTDSQRYLSTRGTSYGLSFEEVVLKGLAPDGGLFIPESIPQLPVGWETKWMNYSFQEL
AFEILSLYISPSEIPSEDLRNIINRSYSTFRSPDITPLVILDDSKQLYLLELFCGPTFAF
KDVALQFLGNLFEYFLVRRNKGKTGKDRHQLVVIGATSGDTGSAAIYGLRGKRDASIFIL
HPKGKVSPIQEAQMTTVLDPNVHNLSVEGSFDDCQDMVKAMFADPEMNKVHKLAAVNSIN
WARIVAQMTYYVHSYFSLIRSPTYAQGKDVRFVVPSGNFGDILAGWFTKQMGLPVEKLVI
ATNENDILYRFWRTGQYTKKPVENGAANAQASSVKETLSPAMDILVSSNFERLLWFLAFK
IYGGDQDIQKQRQQAGDVVRGWLDDLKSKGGFSVEPAILDAAKHDLESERVSDLQTIETI
RDVYCSCFPPPPATSGTRGKTGGYILDPHSAVGVAASLRSISRNPGTHHISLSTAHPAKF
AHAVDLALNGKEGYGFENVLPPEFVGLEKKERRVIEVPAGEGWKAVKKIVDEKVGL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaccgattcgcagagatatcttagtacgcggggtacatcgtacgggctgtct
ttcgaagaggttgtgttgaagggcctcgctccagatggcggacttttcattcctgaatcc
ataccgcagctaccagtgggctgggagacgaaatggatgaattacagcttccaagagttg
gcatttgaaatcctctctctgtatatttcaccgtcggaaatcccttcagaggacttgagg
aatatcataaaccgcagctattcaactttccgatccccagatataacccccctggtcatt
ctcgatgactccaaacaattataccttctcgagctcttttgcggcccgacgtttgcattt
aaggacgtcgctttgcagttcctcggaaatctcttcgagtatttccttgtgcgacgaaac
aagggcaagactggaaaggaccgacatcagcttgttgtcatcggtgccacgagcggagat
actggttctgctgcgatatacggcctgagagggaagagagacgcctccatattcattctt
catccaaagggcaaggtttccccgatccaggaagcgcaaatgacaacagttcttgacccc
aatgtccataacctgagcgtcgaagggtcctttgatgattgccaagacatggtcaaggca
atgttcgccgatcctgaaatgaacaaggtccacaaactggctgctgtaaactcaataaat
tgggcgcgcatagttgctcagatgacctactatgttcactcttacttctccctcatccga
tctccaacatacgctcaaggcaaggatgtacgatttgtcgtaccgtcgggtaactttggt
gatattcttgccggctggttcacaaaacagatgggcctccccgtagagaagttagtcatc
gcaacaaacgagaacgatatcctctaccgattctggagaaccggtcaatacaccaagaaa
cccgttgaaaatggcgccgccaacgcgcaagcaagtagcgtcaaagaaacccttagccct
gccatggacatcttagtgtcaagcaacttcgaacggctgctttggtttcttgccttcaaa
atctacggtggagaccaagatatccagaagcagcggcaacaagctggcgatgtcgtccga
ggatggcttgatgatcttaagtccaaaggtggcttcagtgttgagccagcaatccttgat
gcggccaaacatgatctagaatcagagcgagtctctgatttacaaacgatagaaacaatc
cgtgatgtatattgctcttgcttccctccacccccagctaccagcggaacaagaggaaaa
acaggtggatacattcttgatccacactctgctgttggagttgccgcttcgctccggtct
atatctcgcaaccctggaactcatcacatttccctttcaacggcacatcctgcgaagttc
gctcatgcggttgacttggcgctgaatggcaaagaaggctatggttttgagaatgttctt
cctcccgagtttgtcggattggagaagaaggagcgccgtgtgattgaggttcccgcagga
gaagggtggaaggctgtgaagaaaattgtggatgagaaagttggactgtag

DBGET integrated database retrieval system