KEGG   Paracoccidioides brasiliensis: PAAG_07760Help
Entry
PAAG_07760        CDS       T02230                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAAG_07760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAAG_07760
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PAAG_07760
Enzymes [BR:pbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PAAG_07760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 536 aa AA seqDB search
MSSTDSQRYLSTRGTSYGLSFEEVVLKGLAPDGGLFIPESIPQLPVGWETKWMNYSFQEL
AFEILSLYISPSEIPSEDLRNIINRSYSTFRSPDITPLVILDDSKQLYLLELFCGPTFAF
KDVALQFLGNLFEYFLVRRNKGKTGKDRHQLVVIGATSGDTGSAAIYGLRGKRDASIFIL
HPKGKVSPIQEAQMTTVLDPNVHNLSVEGSFDDCQDMVKAMFADPEMNKVHKLAAVNSIN
WARIVAQMTYYVHSYFSLIRSPTYAQGKDVRFVVPSGNFGDILAGWFTKQMGLPVEKLVI
ATNENDILYRFWRTGQYTKKPVENGAANAQASSVKETLSPAMDILVSSNFERLLWFLAFK
IYGGDQDIQKQRQQAGDVVRGWLDDLKSKGGFSVEPAILDAAKHDLESERVSDLQTIETI
RDVYCSCFPPPPATSGTRGKTGGYILDPHSAVGVAASLRSISRNPGTHHISLSTAHPAKF
AHAVDLALNGKEGYGFENVLPPEFVGLEKKERRVIEVPAGEGWKAVKKIVDEKVGL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaccgattcgcagagatatcttagtacgcggggtacatcgtacgggctgtct
ttcgaagaggttgtgttgaagggcctcgctccagatggcggacttttcattcctgaatcc
ataccgcagctaccagtgggctgggagacgaaatggatgaattacagcttccaagagttg
gcatttgaaatcctctctctgtatatttcaccgtcggaaatcccttcagaggacttgagg
aatatcataaaccgcagctattcaactttccgatccccagatataacccccctggtcatt
ctcgatgactccaaacaattataccttctcgagctcttttgcggcccgacgtttgcattt
aaggacgtcgctttgcagttcctcggaaatctcttcgagtatttccttgtgcgacgaaac
aagggcaagactggaaaggaccgacatcagcttgttgtcatcggtgccacgagcggagat
actggttctgctgcgatatacggcctgagagggaagagagacgcctccatattcattctt
catccaaagggcaaggtttccccgatccaggaagcgcaaatgacaacagttcttgacccc
aatgtccataacctgagcgtcgaagggtcctttgatgattgccaagacatggtcaaggca
atgttcgccgatcctgaaatgaacaaggtccacaaactggctgctgtaaactcaataaat
tgggcgcgcatagttgctcagatgacctactatgttcactcttacttctccctcatccga
tctccaacatacgctcaaggcaaggatgtacgatttgtcgtaccgtcgggtaactttggt
gatattcttgccggctggttcacaaaacagatgggcctccccgtagagaagttagtcatc
gcaacaaacgagaacgatatcctctaccgattctggagaaccggtcaatacaccaagaaa
cccgttgaaaatggcgccgccaacgcgcaagcaagtagcgtcaaagaaacccttagccct
gccatggacatcttagtgtcaagcaacttcgaacggctgctttggtttcttgccttcaaa
atctacggtggagaccaagatatccagaagcagcggcaacaagctggcgatgtcgtccga
ggatggcttgatgatcttaagtccaaaggtggcttcagtgttgagccagcaatccttgat
gcggccaaacatgatctagaatcagagcgagtctctgatttacaaacgatagaaacaatc
cgtgatgtatattgctcttgcttccctccacccccagctaccagcggaacaagaggaaaa
acaggtggatacattcttgatccacactctgctgttggagttgccgcttcgctccggtct
atatctcgcaaccctggaactcatcacatttccctttcaacggcacatcctgcgaagttc
gctcatgcggttgacttggcgctgaatggcaaagaaggctatggttttgagaatgttctt
cctcccgagtttgtcggattggagaagaaggagcgccgtgtgattgaggttcccgcagga
gaagggtggaaggctgtgaagaaaattgtggatgagaaagttggactgtag

DBGET integrated database retrieval system