KEGG   Paracoccidioides lutzii Pb01: PAAG_07948Help
Entry
PAAG_07948        CDS       T02230                                 

Definition
(RefSeq) 20S cyclosome subunit (BimA/Nuc2/Cdc27)
  KO
K03350  
anaphase-promoting complex subunit 3
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    PAAG_07948
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    PAAG_07948
   04113 Meiosis - yeast
    PAAG_07948
Protein phosphatases and associated proteins [BR:pbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PAAG_07948
Ubiquitin system [BR:pbl04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     PAAG_07948
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    PAAG_07948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 812 aa AA seqDB search
MAPSAPHISSQLRQLIYYHLDNNLIRNALFLAGRLHAFEPRSSEASYLLALCHLQSGQSK
AAWEYSRNSGSRGTHAGCSYVHAQACLDLGKYIEGITALDRSKSLWANKNNWNKHSETRR
QHLPDAAACLCLQGKLWHAHQDLHKAVDCYVEALKLNPFLWDAFLGLCQTGANIRVPNIY
KMSPDMLAMLPSSPTTENPPTFEKAAQTNGPLQVQPNINHNVDPFTSFSARVDAANGSSA
LWEKLNGSNVSVSIGAPAPEGLETPVAQSDSDDLRAGGSGGATSGDPSWEPTFAPGRKNR
TIQTLGLDYGVDPPPKMKTTSTKSRNKARVDPEDTYHIAVSRETAPPAFGGGERKRTVSG
QVAHQTATQTSEPGAPQRRSVRLFNQIRPTTSKFSASVTFGVREGREIKKVKATGAKGRN
PSGSTMGRVVSGNRKAAPDGMDIDGKESRGVPASAVPNGAVGGHSKHAATDKSKDVEALN
WILDLFAKLAEGYSALTTYKCQEAIQIFNSLPQSQRETPWVLSQIGRAYYEQAMYVEAEK
YFIRVKTIAPSRLEDMEVYSTVLWHLKNEVELAYLAHELMEIDRLSPQAWCAIGNSFSLQ
SDHDQALKCFKRATQLDHSFAYAFTLQGHEYVSNEEYDKALDAYRYGISANSRHYNAWYG
IGKVYEKMGKYKFAEQHYRTASSINPTNAVLVWCIGLVLERMGNQKAALLQYGRACTLAP
QSVLARLRKARVLMKLNELKLAQVELGILKDLAPDEPNVHYLLGKLYKMLNDKGSAIRHF
TTALNLDPKAAQFIKDAMESLENPEDDDEDMG
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggcaccctccgcccctcacatatccagccagctgcggcaactgatatattatcatctc
gataacaacctcatccgcaatgccctcttccttgccggccgcctccacgcctttgaacca
cgatcatcggaagcttcctacctcctcgccctctgtcatctccagagtggccagtccaag
gctgcatgggaatatagcaggaattcgggttccaggggaacgcatgctggctgctcatat
gtccatgcgcaagcatgtttagatctggggaagtacattgaagggatcactgccttggac
aggagtaagagcctttgggctaacaagaataattggaataagcatagcgaaacacgaaga
caacacctgccagatgccgctgcatgtctttgcttacagggaaaattatggcatgcacat
caagatctacataaagcagtggattgttatgttgaagctttgaaattaaaccctttcctt
tgggacgcctttctaggtctttgccaaacaggtgccaatatccgggttcccaacatatat
aagatgtccccagatatgttagcaatgctcccttcgtcgccaaccacagaaaatcctccg
acattcgaaaaggctgcacagacaaatggacccctgcaagtacaaccaaacataaaccat
aacgtagatccatttacatcgttcagtgctcgcgttgatgctgcaaatggttcctccgca
ctttgggaaaagttaaatggcagtaatgtcagtgtttctatcggtgctcccgcgccggaa
ggtttggaaactcctgtcgcccaaagcgattcggacgacttgcgtgcaggtggcagtggt
ggtgcaacttctggtgacccatcatgggaacccacttttgcacctgggaggaagaataga
actattcagacattgggtttggattatggggtagatccacccccaaaaatgaagactaca
tcaacgaaatccagaaataaagccagggtagatccggaagatacatatcatatcgcagtc
tcaagagaaacagccccgccagcatttggaggaggtgagaggaaaagaacagtatccggt
caagttgcccaccaaacagccacacagacttccgaaccaggagctccacaacgacgtagt
gtacggctctttaaccagattcgccccacgactagcaaattttcagcctcggtgacgttt
ggggttcgggaaggtcgagagattaaaaaggtgaaggcgacaggcgcaaaagggcgtaac
ccttctggttcaactatgggacgggtcgtgagcggtaatcgcaaagctgcccccgatggg
atggacattgacggcaaagagagtcgaggggttcctgcttctgctgtcccgaacggtgcg
gttggtggacactccaaacacgcagcgacggataaatcaaaggacgtcgaagctctcaat
tggattttagatctttttgcgaaacttgcagaaggttactcggcactcacgacatataaa
tgccaggaggctatacaaatattcaattctctcccgcaaagccagcgagaaaccccatgg
gttttgtcgcagataggtcgagcgtattatgaacaggcaatgtatgttgaagccgaaaag
tatttcatccgcgttaaaaccattgcgccgtcgagattagaggatatggaggtttattca
actgttctgtggcacttgaaaaatgaagtggaattggcttatctggcacacgaactgatg
gagatcgaccgcctatcaccacaggcatggtgcgccatcggcaactccttctctctgcaa
tccgatcatgaccaggcgcttaaatgcttcaaacgggccacgcaactggaccacagcttc
gcctacgcctttacattgcagggacacgaatacgtctccaacgaagaatatgataaagcc
ctggatgcctaccggtacggcatcagcgctaacagcaggcactacaacgcctggtacggc
attggcaaagtctacgaaaaaatgggcaaatacaagtttgcagaacaacactaccgtacc
gcctccagtatcaacccgaccaacgccgtgttagtgtggtgtatcggtctcgtgctggag
aggatgggaaatcagaaggctgcgctgttgcagtacggacgggcctgtacacttgcgccg
cagtctgtgcttgcccgcttgcgcaaagctcgggttttgatgaagctgaatgagcttaag
ctagcgcaggttgagcttgggatattgaaagatttagcgcccgatgagccgaatgtgcat
tatttgttagggaagttatataagatgcttaatgataaggggagtgcgattaggcatttt
acaacagcgttgaatttagatccgaaggctgcgcagtttattaaggatgcaatggaatcg
ttggaaaaccctgaggacgacgatgaggatatggggtga

DBGET integrated database retrieval system