KEGG   Paracoccidioides brasiliensis Pb01: PAAG_08038Help
Entry
PAAG_08038        CDS       T02230                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pbl  Paracoccidioides brasiliensis Pb01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAAG_08038
Enzymes [BR:pbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PAAG_08038
Exosome [BR:pbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAAG_08038
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 553 aa AA seqDB search
MNPNQIPLVQALPAAAQQHILDPPKNAYDALDLPPKLIKELYSPSQSPAMAPPNVPPFDD
TIAEVVASETSPDGTGVIKIDPWLEPFKDALRHRFDYTKGWIKRINDTEGGLEKFSRGYE
KFGFNVRDNGNIVYREWAPNAVDAHLIGDFNVEGLPDLLIGGRWTTRVDNWDRKATPMKK
DEYGVWEVSVPAKDGEPAIPHESKVKITLKTPSGETLDRFPAWIKRVTQDPSNEFHAIFW
NPPAAQQYKPKHARPPRPASLRIYEAHVGISSPETRVATYPEFTKNMLPRIKALGYNTIQ
LMAIMEHAYYASFGYQVNNFFAASSRYGTPEQLKELIDVAHGLGIVVLLDVVHSHASKNV
LDGLNMFDGTDGVYFHSGGKGEHGLWDSRLFNYGSHEVMRFLLSNLRFWMEEYGFDGFRF
DGVTSMLYTHHGIGTGFSGGYHEYFGFNVDQEAVTYLTVANEMLHQIYPYCVTIAEDVSG
MPALCLPFSLGGLGFDYRLAMAVPDMYIKMLKEQRDEDWNMGHISHTLSNRRHCEKTIAY
AESHDQAYVHSSL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccaaccaaatccctcttgtccaggctcttcccgccgctgcccaacagcacatc
cttgatccgccgaagaacgcatatgacgctctcgatctaccaccgaagcttataaaggaa
ctttacagcccctcccaatcccccgcaatggcacctccaaacgtgccaccattcgacgat
accattgccgaagtcgtggccagcgagacatccccagatggcactggagtaatcaagata
gatccctggctcgagccgtttaaggatgcgctgcggcacagattcgattatacgaaggga
tggattaaacgcattaacgacacggagggcgggttggagaagtttagtcggggttacgag
aaattcggcttcaatgtacgagataatgggaatatagtgtaccgcgaatgggcgccgaat
gctgttgatgcgcatttaattggagatttcaacgtggaggggttaccggatttgctaatt
ggggggcggtggaccacacgagtagataactgggatcgcaaagcgacaccaatgaagaaa
gatgaatacggtgtctgggaagtcagtgtccccgccaaagacggcgagccggcaatacca
catgagagcaaggtgaagataacgctcaaaaccccctccggcgaaactctcgaccgcttc
cccgcctggataaagcgcgtaacccaagacccctccaatgaattccacgccattttctgg
aatccccccgccgcccagcagtacaaaccaaaacatgcccgcccccccagacccgccagc
ctccgcatctatgaagcgcacgtcggcatctcctcgcccgaaacgcgcgtcgcaacttac
ccggagtttacgaaaaatatgctccctcgcatcaaggcgctgggatacaatacgatccag
ctgatggcgatcatggagcatgcgtactatgccagcttcgggtatcaggtgaacaacttc
tttgcggcgagcagtcggtacgggacgccggagcagcttaaggagttaattgatgtggca
catgggttggggattgtggtgttgttggatgtggtgcatagccatgcgtcgaagaatgtg
ctggatgggttgaatatgtttgatgggacggatggagtgtattttcatagtggagggaag
ggggagcatgggttgtgggatagtcggttgtttaattatgggtcgcatgaagtaatgcgg
tttttgttgagcaatttgcggttttggatggaggagtatgggtttgatgggtttcggttt
gatggggtcacgagtatgttgtatacgcatcatgggattgggacgggcttctccggtggc
taccacgaatacttcggctttaacgttgatcaggaggctgtaacctacctcactgtcgcc
aacgaaatgctgcaccagatatacccatattgcgtcactatcgcagaagacgtctctggc
atgccggcgctgtgcctccccttttcccttggcgggttaggattcgattaccgcctcgcc
atggcggtgccggacatgtacatcaagatgttgaaggagcagcgggatgaggactggaac
atgggacatatctcacacacactgtcaaaccgtcgacactgcgagaaaacgattgcttac
gcagagagccacgaccaggcgtacgtccactcctccctctaa

DBGET integrated database retrieval system