KEGG   Paracoccidioides brasiliensis: PAAG_08152Help
Entry
PAAG_08152        CDS       T02230                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAAG_08152
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PAAG_08152
Transfer RNA biogenesis [BR:pbl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PAAG_08152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSYQQELYVAELAVQRATLFTQKVFREKTKGTLSKDDKSPVTKGDFGAQALIIQAIRKNF
PDDEIVAEEEATALRGDKPLSNEIWGLLKDIRLADEESEKVLGGPLQSEEAMLDILDQGK
SAGGPHGRIWALDPIDGTKGFLRGGQYAVCLGLIVDGDVKVGVIGCPNLPVSDSAPIPID
LNAQQGGEESGVLFSAILGKGASSRPLSEGKLQKSKSLLMKPVPDITQASLCESVEEAHS
AQGDTAAVAKMLGISGTPVRLDSQAKYCSIARGAGDIYLRLPTRKDYQEKIWDHAAGDLL
VREARGMTTDIHGNRLNFGKGRTLADNKGIVAAPKAIHDQLLNAVQKVLKLK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccagcaagagctctacgtggcagaactagcagtacagagagccactttgttc
acgcagaaagtattccgcgaaaaaacaaaaggcaccctatccaaggatgacaagtcccct
gtcacgaagggcgattttggtgcacaggctttgattatccaggctattcgcaagaatttc
ccagacgatgagattgttgcggaggaggaagcgactgccctcagaggagacaagccattg
agcaatgaaatttggggtctgctcaaagatattaggctagctgacgaggaaagtgagaag
gttcttggtggaccattgcagagtgaggaggctatgctggacatcctcgaccaggggaaa
agtgctggaggaccacatgggagaatatgggctttggatcccatcgacggcacaaagggg
tttctccgtggaggccaatatgccgtttgcctcggcttgattgtggatggggacgttaaa
gtaggagtcatcggttgccccaatttgccagtgtctgactccgcgccgatccccatagac
ctgaatgctcagcaaggcggcgaggagagcggggtactcttttctgcaatacttggtaag
ggagcctcgagccgccccttatctgaagggaaattgcaaaagagcaaatctctcttgatg
aaaccagtgccagatattacacaggcttcactttgtgaaagtgttgaggaagcgcattcc
gcacaaggtgataccgctgctgtggctaagatgctagggatcagtggcacacctgtgcgg
ttggattcgcaagctaaatactgctccatcgctcgaggggctggcgatatttaccttaga
ctgcccacgagaaaggattatcaagagaagatttgggaccatgctgcgggggacttgtta
gtccgcgaggctagaggaatgacgaccgatatccacggcaacagacttaactttggcaaa
gggagaacgttggctgacaacaaggggatcgttgccgccccgaaggctatccatgaccaa
ttgcttaacgccgtgcagaaagtgctgaaattgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system