KEGG   Paracoccidioides brasiliensis: PAAG_08207Help
Entry
PAAG_08207        CDS       T02230                                 

Definition
alanine aminotransferase
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_08207
   01210 2-Oxocarboxylic acid metabolism
    PAAG_08207
   01230 Biosynthesis of amino acids
    PAAG_08207
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAAG_08207
Enzymes [BR:pbl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PAAG_08207
Amino acid related enzymes [BR:pbl01007]
 Aminotransferase (transaminase)
  Class I
   PAAG_08207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 556 aa AA seqDB search
MANRHISNFCSLSRRYCRPHPLSIPVDAHCTRPRLLGLQGFPRISSSSPPSVSPIFHLQL
RNMGSVSKSEPKGRLHGGNINPNVLAAKYAVRGELAVKAEEYRERLANAEKENIQDVLPF
DKVIFANIGNPQQLDQKPITFFRQVLSILEHPALLENEEALKTSFGYKQDVIDRAKRLLK
GVQSVGAYSQSHGVPVIRESVAKFIERRDGFPADPARIYLTAGASSGVNTLLHVLCAGPK
TGVLVPIPQYPLYTATLSLLNAKCVPYYLNESDSWGTDVDGIRSTISQAKEDGIDVRAIV
VINPGNPTGASLTSDSVKGVIDVAVESNLVILADEVYQANVFEGDFTSFKKRLRQLQRDF
PSQYDHVELASLHSISKGMVGECGHRGGYIELVGFHEDVLENIYKFISIMLCAPVVGQCL
VEMMVNPPVEGDPSFELYQKEYNSIRDGLYQRAQTLYKAFQQMEGVECQEPKGAMYLFPT
IHLPPKAIEAAKAANREPDEFYSLRLLDATGVCVVPGSGFGQKDGTLHFRTTFLAPGTAW
TDRIVKFHKEFMDEFR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcgacacatatcgaatttctgctcgctctcacggcgctattgtcgcccccac
cccttgtcaattccagtcgatgctcattgtacaagaccccggttgctaggtctccaaggc
tttccccgcatttcctcttcatcgccaccgtctgtttcaccaatattccacctccaactt
cgaaatatgggctccgtctcaaaatcggaaccaaaaggccgtcttcatggcggcaacatc
aatcccaatgtcttggctgccaagtatgcggtccgtggtgaactagccgtcaaggcggag
gaatatcgtgagagactggccaatgctgaaaaggaaaatatccaagacgtgctccccttt
gacaaggtcatcttcgccaatatcggaaatccgcaacaattagaccaaaaacccatcaca
tttttccgccaggtccttagcattctcgagcacccggccctgctagaaaatgaggaagcg
ctgaagacctcctttggctacaaacaggatgtcattgacagagcaaagaggctgctgaaa
ggtgtccaaagcgtgggcgcgtacagccagagtcatggggttccggtcatacgggagagt
gttgccaaattcatcgagcgccgcgatggcttcccggcggatccggcccgtatttatctc
actgccggagcatcgtccggagtcaacaccttgctccatgtgctctgcgctggcccaaaa
actggtgtgctcgtacccattccgcaatatccgctctatactgccaccttgtccctgtta
aatgccaaatgcgtgccatattatcttaacgaaagcgactcttggggtaccgatgtagat
gggatcagatcaaccatttcacaggccaaggaggatggaatcgatgtccgtgccatcgtg
gtcattaaccctggaaatccaaccggtgctagtttaacctcggactcggtcaagggtgtt
atcgatgtcgcagtcgaatccaacctcgtgatcttggccgatgaagtctaccaagccaac
gtcttcgagggagattttacttcattcaaaaagcgcctacgacaactccaacgagacttc
ccgagtcaatatgatcatgtcgaactagcgtcgctgcatagcatttcgaaaggcatggtt
ggtgaatgtggtcacagaggcggttatatcgaactcgtcggcttccacgaggatgtcttg
gagaacatctacaaatttatcagtatcatgctctgcgctccagtcgttggacaatgtctc
gttgagatgatggttaaccctcccgtagaaggagatcccagtttcgagctgtaccagaaa
gagtataatagcattcgagacggcctgtatcagcgtgcccaaaccctttacaaggcattc
cagcagatggagggcgttgaatgtcaagaacccaagggcgccatgtatctcttcccaacc
atacatctaccacccaaagcgatcgaagctgccaaagcagccaaccgcgaaccagacgaa
ttttactccctccgcctcctggatgccacaggggtctgcgtcgtccctggatccggcttc
ggtcagaaagatggcactctccacttccgcaccacgttcttagcaccaggcactgcatgg
acggatcgcatcgtcaagttccacaaggaattcatggatgaatttagatga

DBGET integrated database retrieval system