KEGG   Paracoccidioides brasiliensis: PAAG_08369Help
Entry
PAAG_08369        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PAAG_08369
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PAAG_08369
Peptidases [BR:pbl01002]
 Metallo Peptidases
  Family M67
   PAAG_08369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 528 aa AA seqDB search
MLPPLSVEQIARQASEFEFDPFSPLRYWIRAAGLLVKEASIYEREGNDQQAYLLLFRHAQ
LVLSHIATHPDARLEDNRKAIAAAKREVQKNLTKLELLKPRINKRYEQYTQLSRNREAKR
TPPLPENGNLITANAPADPALAGVPEPLDAAKNREFAVKLAQREFSRRATARAVSEPCDT
YEQTDDLSQRLQDVWSQVLRTETTVRRQPSSPSQPSTRNDHGQNRTIYPRPSSSRPVSSF
KYPSVPRQQASGVEQLPPPLPDKEELVASNTLLPPQLPAKIQESSLSPPARSTNLPFPPL
SPLPIPSKVSTVCLTSTNDISTRSITPSVDPQPSGFTFKPSAYLENGTPLRTIFISPDLR
KKFLSIAAPNTQRNLETCGILCGTLISNAFFISTLLIPDQESTSDTCEMINEAVIFDYCD
SEDLMVLGWIHTHPTQTCFMSSRDLHTQSGYQVMLAESIAIVCAPSKDPDWGVFRLTDPP
GLKCVLACTQPGIFHPHAESNIYTDALRPGHVFEAKGLEFEIVDLRLR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttaccgcccttgagtgtcgagcagattgcccgtcaagcttcagaattcgagttcgac
cctttctctccattacgttactggatacgggcagccgggctactagttaaagaggctagc
atatacgaacgcgaaggaaacgatcaacaggcatatcttctgcttttcagacatgcgcaa
cttgtactctcacatattgcgacccatccggatgcgcgactggaggataatcgcaaagct
atagctgccgcaaaacgggaagtccaaaagaacctcaccaaactcgagctgttaaaacct
cgtatcaacaaacgatatgaacaatacactcagctttcccgtaacagagaggccaaaagg
acacctcctctaccagaaaacggtaatcttataactgcaaatgccccggctgaccctgca
ttagctggagttccggaaccgttagatgcagctaagaatagggagttcgctgtcaaactt
gcccagagggaatttagccggcgagcaactgctcgcgcggtatctgagccttgcgatacc
tatgagcagacagatgacctcagtcagcgtctccaagatgtatggtctcaagtcttaaga
acagagacaacggttagaagacaaccgtcaagcccgagtcaaccttcaactcgcaacgac
catggacaaaacaggaccatatacccaagacctagtagttcaaggcctgtgtctagtttc
aaatatcccagtgttccccgccaacaggcttctggtgttgaacaactgcctccgccccta
cctgataaggaggaacttgttgcatccaacacacttctcccaccgcaactcccggccaag
atacaggagtcttccctgtcacctccagcgcggtctaccaacttaccttttcctccacta
tctccccttcctattccgagcaaggtatcaactgtttgtctaacttcaacgaacgacatt
tctaccagaagtataactccatctgtagacccccagccatcaggatttacctttaaacct
tcagcctatcttgaaaatgggacccctcttcggacaattttcatttctcccgatctccgg
aaaaagttcctttccatcgctgcccctaatacgcagcgcaacctcgaaacctgtggtatc
ttatgcggaacactaatatccaacgctttctttatctccacactcctcatacctgaccaa
gagtctacatcggacacctgcgaaatgatcaacgaggccgtcatttttgactactgcgat
tccgaagatctgatggttcttggttggatacatactcacccaacacaaacctgcttcatg
agctcccgcgatttgcacacgcagtctggctatcaagtaatgttagcggaaagtattgcg
attgtttgcgcacccagcaaggatcccgactggggggtgttccggcttacagatccccca
ggattgaagtgtgtgctcgcatgcacacaaccgggtattttccatccgcatgcagaatct
aatatctatactgatgcactgaggcctggtcatgtttttgaggctaaaggtttggagttt
gaaattgtagatttgcgccttcgatag

DBGET integrated database retrieval system