KEGG   Paracoccidioides brasiliensis: PAAG_08431Help
Entry
PAAG_08431        CDS       T02230                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    PAAG_08431
Enzymes [BR:pbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     PAAG_08431
Glycosyltransferases [BR:pbl01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   PAAG_08431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 745 aa AA seqDB search
MAAYESAITTGASQNSDLRRRNVFGLQKGDSGASNVRVEIDGKKATPHKFSFIDVLDEWE
VIIAPLIFTALSFFTRMWRIGRSDIVTWDEAHFGKFGSHYLKREFYFDVHPPLGKMLVGL
SGYLAGYNGSFEFKSGEKYPPDLNYTFMRSFNAIFGAVCVPLAYYTAREMNFRRSTVWLV
TLMVLCENSYATISRFILLDSMLLCFTFTTVLCWARFHRLQNKSFTVEWFTWLMLTGLSI
GCVCSVKWVGFFVTAMVGLYTAEDLWNKFGDLKMPKVVLAQHLAARVAGLIVVPLLVYMF
SFYLHFLVLENSGPGDAQMSSLFQANLKGTSVGKDNPLEIAIGSQATLKNMGYGGGLLHS
HVQSYPEGSGQQQITCYHHKDANNDWFFYPSRDEPDYNPEAPLNFIGDKDVIRLVHAQTG
RNLHSHPIAAPVTKSSYEVSGYGNTTIGDHKDHWVIEVVNDVASKDRSKIRTLTTAFRLR
HAVLGCYLRAGNVNLPQWGFKQIETTCVKQNNPRDIYTHWNVESHINDRLPPGDPGSYKS
PFLKDFLHLNVAMMTSNNALVPDPDKQDDLSSEFWEWPILHVGLRMCSWEDNVVKYFLLG
NPIVYWGGTASLVVLSMILLWYLVRWQRGYDELNMAEIDHIYYSGIYPAIAWFFHYFPFI
AMARVTYVHHYYPALYFSILTLAFCVNWFTRKLPAKVEWAIYTVLYAAVIGLFLHFRDIV
FGMEGPSSKWEHLSWFSVWRISNAI
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctatgagtctgccatcacaacgggcgcctcacagaactccgatcttcgtcga
agaaatgtctttggcttgcaaaaaggagacagtggggcgagcaacgtccgggttgaaatc
gacgggaaaaaggcaacaccacacaagttctcattcatcgatgtacttgacgagtgggaa
gttatcattgcccccctgatattcactgcactctccttcttcacacgaatgtggcgtatc
ggtcggtcggatattgttacatgggatgaagctcattttggcaagtttggctcccattac
ctgaagagggagttctatttcgatgtccatccgccgctggggaaaatgctagtgggcctg
tcgggttaccttgcgggctacaatggctcgtttgagttcaaatctggagaaaagtaccca
ccggatcttaactataccttcatgcgttcgttcaatgccattttcggagccgtctgcgta
ccgctagcatactatacagcccgcgaaatgaacttccgccgctcgactgtctggttggtg
actctaatggttctctgtgagaactcctatgccaccatctccagatttattcttctcgat
tctatgctgttatgcttcactttcacgactgttttgtgctgggcgcgatttcaccggctt
caaaataaaagtttcacggtggaatggtttacatggctcatgctgacagggctgagtatt
ggctgtgtctgcagtgtgaagtgggtggggttctttgttactgcgatggttggactatac
actgctgaggatctgtggaacaagtttggcgatctaaaaatgcccaaggttgttcttgca
caacatctcgcggctcgagtagcaggattgattgttgttcctcttcttgtctacatgttt
tcgttctacctgcatttcctcgtgctcgaaaactcgggacctggcgatgcgcagatgagc
tctcttttccaagccaacctaaagggcaccagcgttgggaaagacaacccccttgaaatt
gcaataggatcgcaggcaaccctgaaaaacatgggatatggtggcggtctcctccactcc
catgtccaatcctaccccgaaggatcaggtcagcaacagatcacttgctatcaccacaag
gatgccaataatgactggtttttctatccgagccgagacgagcccgattacaacccggaa
gctcctttaaattttattggtgacaaggatgttatccggctcgttcacgctcagacagga
cgtaatctgcattcgcatcctatagctgcaccagtgaccaagagcagctacgaagtatca
ggttatggaaatacaacaattggagaccataaagatcactgggtcattgaagtagttaac
gatgtcgcatccaaggacaggtcgaaaattcggactttgacaactgctttccgccttcgc
cacgctgttctgggctgctatcttcgcgcaggcaacgttaatcttccacagtggggtttc
aagcaaattgaaactacatgcgtcaaacaaaataatccccgagacatttacactcattgg
aatgttgagagtcacattaatgacaggctcccacccggtgaccctggttcctacaaatcg
ccattcctaaaggacttcctccacctcaacgtggccatgatgacatcaaacaacgccctt
gttcctgacccggataagcaagatgacctctcctccgagttttgggagtggccaatcctc
cacgtaggtctccgcatgtgttcctgggaggacaacgtcgtcaaatacttcctcctcgga
aaccccatcgtctattggggaggaaccgccagtctcgtcgtcctcagcatgatcctgctt
tggtacctggtccgctggcagcgcggctacgacgaactcaatatggccgagatcgaccac
atttactattccggcatatacccagcgatcgcatggttcttccactacttcccctttatt
gcaatggctcgcgtcacctacgtgcaccactattacccagcgctgtatttttccatatta
acactggctttctgcgtgaactggtttacgcggaagctccccgcaaaagttgaatgggcc
atctacacagttctctacgcggctgtcattgggctcttcttgcatttccgtgacatcgtc
tttggaatggaagggcctagctcgaaatgggagcatttgtcctggttcagtgtgtggcgg
attagtaatgcaatatga

DBGET integrated database retrieval system