KEGG   Paracoccidioides lutzii Pb01: PAAG_08467Help
Entry
PAAG_08467        CDS       T02230                                 

Definition
(RefSeq) histone deacetylase hda1
  KO
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     PAAG_08467
Protein phosphatases and associated proteins [BR:pbl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAAG_08467
Messenger RNA biogenesis [BR:pbl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     PAAG_08467
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     PAAG_08467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 753 aa AA seqDB search
MSTMEEDEDVVMAGMAPPTMIPIGPGRPSSTTPEKPPSPLELNGVTTAPVPDETPLIQSF
REKLPISINIAKDADSPQDHATVSTPERISPEESKSNTDEDSLVEEDSDWPNDMAEENKG
LPLASLPTGLCYDIRMRYHCEVKPTLDVHPEDPRRIYYIYKELCKAGLVEDPESSKPLVS
LPLHRILARDATEEEIALVHDPEHYAFVKSTKDMSEDDLIALEHTRDSIYFNSLTFTSAI
LSCGGAIETCKAVVDRQVKNAIAVIRPPGHHAEHNKTMGFCLFNNVCVAARVCQREFGEK
CRKILILDWDVHHGNGIQKAFYDDPNILYISLHVYRDGSFYPGGDEGNWDRCGEGNGFGK
NINIPWPTQGMGDGDYMYAFQEVIMPIAYEFDPDLVIISAGFDAAAGDELGGCFVTPPCY
AHMTRMLMNLAGGKVAVCLEGGYNFRSISKSALAVTRTLMGEPPDRLYSASASRPAVHTV
KRVAMIQSAYWKSMYPKGPPEIFQGNRMHDIIRQYQAKQLYDDCKLTNLYIYRDTISKSF
ENQVLASPELMGIPHPVTNILEPHNCWIADVIKDYVSWAIQNNFGVIDVNIPKHITLSKK
SNTYQDETRTRMQMSDQLATYLWENYIEPNDATSIFFLGVGDAYYGLTNLLVNTERVHER
VNGVISFVAENPVRAVSSNTTTWLSKWYKDNSMVFVSHLHSVWSGPENSRKFSKRHGRLI
RSPNRGLNEMLNAHKEQVFKFIVDRVEGAGVEE
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccatggaagaagatgaggatgtcgtcatggccggcatggctccgcctaccatg
attcccattggccccggtcgtccttcgagtactactccggagaaacctcccagccctctg
gaattaaatggagtaacaacagccccagttcccgatgaaacaccattaatccagtcattc
cgagagaagctccctatttctataaatattgccaaagacgccgactccccacaggaccat
gctacagtttccacccctgaaaggatatcgccagaggaatccaaatctaacacagacgag
gacagcctggtcgaagaagattccgattggcccaatgacatggccgaagagaacaagggt
ttgccccttgcgtctcttcccacaggtctatgctatgatattcgcatgcgttatcactgc
gaagtcaagccgactttggacgtccatccggaagatccacggcgaatttattacatttac
aaggagctttgcaaggcagggctggttgaggatcccgagtcttcaaagccgctcgtctct
ctgccgctacaccgaatactggcaagagatgctactgaggaagagatagcgttggtgcat
gatccggaacattatgcttttgttaaaagcacgaaagatatgtccgaggatgatttgatc
gcgcttgaacacacgcgggattcgatttatttcaattccctcacattcacatctgccata
ctctcgtgtggtggcgccattgagacgtgtaaggccgtcgtggatcgccaggtgaagaat
gccattgcggtaatcaggccgccgggccatcacgctgaacataacaaaactatggggttt
tgtttgtttaataatgtttgcgttgcggccagggtatgccagagagagttcggagaaaag
tgtcggaagatattgattctggattgggacgtacatcatggaaacggcatccaaaaagct
ttctatgatgatccgaacatcctttatatatctcttcatgtgtatagggatggctccttt
tatcccggtggtgacgaaggtaactgggaccgctgtggtgaagggaacggatttggaaag
aatatcaatattccctggccaacacaagggatgggtgatggcgattacatgtatgccttc
caggaagtgataatgcccatagcttatgaattcgatccagatctagttatcatatctgct
ggtttcgatgcggctgccggtgacgaattaggaggatgctttgtaacccctccttgctat
gcccatatgacccgtatgcttatgaatttggctggtggtaaagtggctgtttgtctagag
ggagggtataattttagatcaatatccaagtctgcgcttgctgtaacgaggacattgatg
ggtgaaccgcccgaccgtctttattcggcatctgcatcgagacctgcagtgcacaccgta
aagagagtcgcaatgattcagtcagcgtattggaaaagcatgtatccgaaaggccctccg
gagatattccagggtaatcggatgcacgatatcatacggcaataccaagcgaaacagctt
tacgatgattgcaaacttacaaatctttacatatatcgagacacaatctcgaaatcattt
gagaatcaagtgctcgcgagtcctgaactcatgggcattccacaccctgtcaccaacata
ttggaaccacataactgctggattgctgatgtcatcaaggactatgtctcatgggccatt
cagaacaattttggcgtcattgatgtcaacattcccaaacacattactttatctaagaaa
tcgaacacgtaccaagatgagacccgcacacgaatgcagatgagtgaccaacttgccacg
tatctttgggagaattatatcgaacccaacgacgcaacaagcatttttttccttggggta
ggtgatgcatattacggtctaacaaacctcttagtgaatacagaacgagttcacgaacgc
gttaatggtgtcatctcattcgtggctgaaaaccccgtccgcgctgtctcgagcaacacc
accacctggttgtcgaaatggtataaagataactccatggtcttcgtctcgcacctgcac
agtgtctggtccgggccagaaaacagtcgcaagttctcgaaacggcatggccgtctgatc
cgctcacctaaccgggggctcaatgagatgcttaatgcgcataaggagcaagtgtttaag
ttcatagtggatagagtggaaggagcaggtgttgaggagtga

DBGET integrated database retrieval system