KEGG   Paracoccidioides lutzii Pb01: PAAG_08731Help
Entry
PAAG_08731        CDS       T02230                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00061  Fatty acid biosynthesis
pbl00620  Pyruvate metabolism
pbl00640  Propanoate metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
pbl01212  Fatty acid metabolism
Module
pbl_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAAG_08731
   00640 Propanoate metabolism
    PAAG_08731
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PAAG_08731
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PAAG_08731
Enzymes [BR:pbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     PAAG_08731
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PAAG_08731
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PAAG_08731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACC_central Carboxyl_trans CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATPgrasp_Ter ATP-grasp_3 Biotin_lipoyl_2 Dala_Dala_lig_C GxGYxYP_N
Motif
Other DBs
NCBI-GeneID: 9092570
NCBI-ProteinID: XP_015701399
UniProt: C1HD90
Position
Unknown
AA seq 2297 aa AA seqDB search
MGVTVTPSTATNGFGSSFAAKHNLPSHFIGGNRLDLAPPGKVKDFVAKNDGHSVITSVLI
ANNGIAAVKEIRDVRKWAYNTFGDERAIQFTVMATPEDLRANADYIRMADQYVEVPGGTN
NNNYANVELIVDIAERMGVHAVWAGWGHASENPKLPESLAASPKKIIFIGPPGSAMRSLG
DKISSTIVAQHAGVPCIPWSGEGIDDVTIDEDGIVTVEDHIYDKGCTHSPQEGLEKARII
GFPVMVKASEGGGGKGIRKVDREEDFINLYNAAASEIPGSPIFIMKLAGNARHLEVQLLA
DQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPETFRAMERAAVRLGKLVGYVSAGTVE
YLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVD
PNTSSEIDFHFENEESTKTQRRPKPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSN
VWGYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIK
LLETPAFEDNTITTGWLDQLISNKLTAERPDPMIAVICGAVTRAHLSSEACIAEYRKGIE
KGQVPSKDVLKTVFPVDFIYEGFRYKFTATRSSNDNYHLFINGSKCSVGVRALADGGLLV
LLDGRSHNVYWKEEAAATRLSVDGKTCLLEEENDPTQLRTPSPGKLVKYTVENGEHVKAG
QPFAEVEVMKMYMPLIAKEDGIVQLIKQPGSTLEAGDILGILALDNPSRVKHAQPFLGQL
PDLGPPQVVGNKPPQRFGLLHNILWDILRGFDNQVIMGATLKELVEVLRNPELPYGEWNA
QVSALHSRMPQKLDSLLAQVVDRAKTRKAEFPANQLMKTLSRFIDENVTPADADILRTSL
QPLVDVIRRYSEGLKVHEYKVFIGILQQYWDVEHLFAGRNMRDEDVILKLREENKDDIFG
VIQTVLSHSKVGAKNNLLLAILDMYRPNKLNAGNVGNYLKPILKKLAELESRATSKVALK
AREVLIQCALPSLEERVAQMEHILRSSVVESKYGETGWDHREPDINVLKEVVDSKYTVFD
VLPLFFGHQDQWVSLAALEVYVRRAYRAYKLKGIEYHNQHESPFFISWDFTLGKAGGQSD
FGMVAGSSHPSTPTTPTMESNPFKKISSISDMSYLVNKGVNEPMRKGVIIPVNYLDDAEE
MLSRALEVFPRAESQKSSGNSIGLSLAALRKPTRVESIDELTGVCNVAIRDIEDLDDTEM
VSRITKLVSEVKEELLVRRVRRLTFICGHKDGTYPGYFTFRGPTYDEDESIRHSEPALAF
QLELGRLSKFRIKPVFTENRNIHVYEAIGKGPESDKAVDKRYFTRAVVRPGRLRDDIPTV
EYLISEADNLMNDILDALEIIGNNNSDLNHIFINFTPVFPLQPVDVERALAGFLERFGRR
LWRLRVTGAEIRILCTEPTTGMAYPLRVVINNTSGYIIQVEMYAERKSEKGEWIFQSIGG
TTKIGSMHLRPVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNCWTKASEEHS
SLADKRPAVGECIDYNELVLDDSDNLIEVAREPGTNTHGMVGWMITARTPEYPRGRRFIV
IANDITFQIGSFGPQEDKFFHKCTELARKLGIPRIYLSANSGARIGMAEELMHHFSVAWN
DPERPEAGFKYLYLTPEVKKRLDERKTKNVITELVTENSEERHMITTVIGAEDGLGVECL
RGSGLIAGATSKAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKL
LGREVYTSNLQLGGTQIMYKNGVSHMTANDDFEGIQKIVQWMSFIPDKKNSPVPIRPYSD
TWDRDIGYYPPARQPYDVRWLIAGKQDEEGFLPGFFDKDSFQETLAGWARTVVVGRARLG
GIPIGVIAVETRSVDTVTPADPANPDSMELISTEAGGVWYPNSAFKTAQALKDFNFGEQL
PVMILANWRGFSGGQRDMYNEVLKYGSYIVDALVKYQQPVFVYIPPFGELRGGSWVVIDP
TINPEQMEMYADEESRGGVLEPEGIVNIKYRRDKQLDTMARLDPEYGELRKALNDKSLPA
DQLSKIKAKMTEREEQLLPVYMQIALQFADLHDRAGRMEAKGTIRQALQWKNARRFFYWR
LRRRLSEELILKRMAAASPSTASRNSAVPNINATSPSSPLKPTTPSRRDANLNTLQSWTG
MLDREFDFNDRKVALWYEENKKKVLENVEQMKVDGVAIEVAQLLMGNKDGGLRGVQQVLS
MLPVEEREAVLKYLGSP
NT seq 6894 nt NT seq  +upstreamnt  +downstreamnt
atgggggttacagtcacaccttcgaccgccacgaatggctttgggagctcattcgcagca
aaacataacttaccgtcacactttatcggaggcaatcgcctagatcttgcacctccgggg
aaagtgaaggactttgttgcgaagaatgatggtcattcagtaattacttcggttcttatc
gcaaataatggcattgctgccgtcaaagaaattcgagatgtccgaaaatgggcctataat
acatttggcgatgagcgggcaattcagtttacggtcatggctacaccggaggatttaaga
gcgaatgcagactatattcggatggcagaccaatatgttgaggtccccggaggcacaaat
aacaacaattatgctaatgtagaactgattgtggacattgcggagcgtatgggtgttcat
gctgtttgggcaggatggggccatgcttcagaaaacccaaagctgccagaatcgcttgct
gcatctccgaaaaagataatttttattggccctcccggttctgcaatgcgatctcttgga
gataagatttcttccaccatcgttgcgcaacacgccggagttccctgcattccttggtcc
ggagaaggtatagatgatgttacaatcgatgaagatggtatcgtgaccgtcgaggaccat
atttatgacaaaggatgcacacattctccgcaagaagggcttgaaaaagctaggattata
ggttttcccgtcatggtcaaggcatcggaaggaggaggtgggaagggtattcggaaagtt
gatagagaagaggatttcatcaacttgtataatgccgcggcgagcgagattcccggatcc
ccaatcttcatcatgaaattagcgggtaacgcgagacatttggaggttcagttattggcc
gatcaatatggaaacaatatctctctgtttggtcgtgattgttcggtacagagacggcac
cagaaaattatcgaggaggcccctgtcactattgcaaagccggagacatttcgagcaatg
gagcgagccgctgtgaggcttgggaagttggttggctacgtttctgcaggaacggttgaa
tacctctattcccatgcggatgacaagttttatttcctggagcttaacccccgtctgcaa
gtcgaacatcccacaacagaaatggtttctggcgtgaatctcccagctgctcagctccag
attgccatgggaattccactacaccgcattcgcgatattcgtcttctttacggcgtggat
cccaacaccagctccgaaatcgacttccattttgaaaatgaggagagtaccaagactcaa
cgccgaccaaaaccaaaaggccacacaactgcttgtcgtatcacttccgaagatcctggt
gaaggcttcaagccatccagcggaacaatgcacgaactcaactttcgaagcagctctaat
gtctggggttacttctctgttggtaccgctggtggaattcacagcttctccgattctcaa
ttcggccatatctttgcctacggtgagaatcgctctgcttcgcgaaagcacatggtcgtt
gcactgaaggagttgagcattcgaggcgatttccggacaaccgttgagtatctcatcaaa
ctacttgagacacccgcttttgaggacaataccatcacgactggttggttggatcagttg
atttccaataagctgacggctgaacggccagatccaatgatcgctgtgatctgcggagct
gttactagggctcatctttctagcgaggcgtgtatcgcggagtaccggaagggcattgag
aagggtcaagtaccttccaaagatgttttgaaaacggttttccctgtcgattttatttac
gaaggattccgatataaattcacggccacgagatcaagtaacgataactatcatctcttc
attaatgggtccaaatgctccgttggggttcgagctcttgctgatggcggattgcttgtt
cttttggacggacgaagccataatgtttattggaaggaggaagccgctgcaactcgtctg
agtgtcgatggcaaaacatgtctgctcgaggaggagaatgaccccacacaactccgcaca
ccgagccctggaaagctggtcaagtacactgtggaaaatggggagcatgttaaagccgga
caaccattcgctgaggtcgaggtcatgaagatgtacatgccactcatcgccaaagaggat
ggaattgtccaactgataaagcaacctggatctactctcgaagctggagatattctgggt
attctcgcattagacaatccatccagagtgaaacacgcgcagccattccttgggcagtta
ccagatttaggccccccgcaagtcgtcggtaataagcctccccaacgatttggcttgctg
cacaatatcttgtgggatattctccgtgggtttgacaaccaagtcatcatgggagccact
ttgaaagagttggttgaagttttgcggaaccccgaacttccctatggagagtggaacgct
caagtctcagcccttcactcacggatgccacagaagctcgattccctacttgcacaagtt
gttgacagagccaaaacgcgaaaggcggagttccctgccaaccagttgatgaagacactt
agccgcttcatcgatgaaaatgttacacctgccgacgctgatattctccgcacaagtctc
caacctctcgtggatgtcattcgacggtatagtgagggattgaaagtccatgaatataaa
gttttcattggcattcttcaacagtactgggacgttgaacacctattcgcaggccgaaat
atgcgcgacgaagatgtgatccttaaactaagagaggagaacaaagatgacatttttggt
gtcatacaaacggttttgtcccacagcaaggtcggggcgaagaacaatttgctcttagcg
attttggatatgtatcgccccaacaaattgaatgccggcaacgtggggaactatttgaaa
cctatcctaaagaagctggcagagctggaatcccgcgcaacttctaaagtcgcgctgaaa
gcccgcgaagttcttatccagtgcgctcttccatccctggaggagagggtcgcccagatg
gagcatatcctgcgatcttcagtggtggaatcgaaatacggagagaccggctgggatcat
agagagcctgacatcaatgtcttgaaagaagtggttgactcgaagtacactgtctttgac
gttctccctctgttcttcgggcatcaggaccaatgggtatccctggcagcgctcgaggtg
tatgtccgccgtgcctatcgagcgtataaattgaagggtatcgaatatcacaaccagcac
gagagtccgttctttatttcctgggatttcactctcggaaaggctggtggccaatctgat
tttggaatggtggccggttcatctcacccgtccactcccaccacgcccacgatggaaagc
aatccgttcaagaaaatcagctccattagtgacatgtcatacttagttaacaaaggggtc
aatgagccaatgaggaaaggtgttatcattcccgttaattatctcgatgatgccgaggag
atgctttcgagggcactggaggtttttccccgcgcagagtctcagaagagcagcggaaac
tccattggcctatctttagcggctttgcgcaagccaacacgtgttgaaagcatcgacgag
cttactggcgtttgcaacgttgcgatccgtgatatcgaggaccttgatgatacggagatg
gtgtcgcgcattaccaagcttgtctctgaagtcaaagaagagcttctcgttcgtcgggtg
agaagacttacatttatctgcgggcataaggatgggacttatcctggttattttacgttc
agaggacctacttacgacgaagatgagagcattcgacacagtgaacctgcacttgcattc
caactggaattgggaaggctttccaaatttagaattaagcctgtctttacggaaaatcgg
aatattcacgtttacgaggcaattggaaaggggccggagagtgacaaggctgttgataaa
cgttatttcacgagagctgttgttcgcccgggccgattgcgagatgatattcccacggtg
gagtatcttatctctgaggctgacaacttaatgaatgacatcctggatgctctggaaatt
attggcaataacaactctgatttgaatcatatctttatcaactttacgcccgtttttccc
cttcagccggttgatgtcgaaagggccttggcaggctttttggaacgctttggtcgacga
ctctggcgcctccgcgtcactggagctgaaatccgtatcctctgcacggagccgacgact
ggaatggcctatcccctccgtgtagttatcaataacacctcaggatacattattcaagtt
gaaatgtatgctgagcgaaagtccgagaaaggggaatggatattccagagcatcggtggc
acgacaaaaataggatccatgcatcttcgtccagtttcaacaccgtatcccacgaaggaa
tggctgcaacccaaacgatataaggcccatttaatgggtactcaatacgtctacgacttc
ccggagctattcagacaggcttttcagaactgctggacaaaggctagtgaagagcattct
tccctcgctgacaaacggcctgctgtgggcgagtgtatcgactacaacgaactcgtgctt
gatgattctgacaatttaatcgaggtcgcgcgagagcctgggaccaatacgcatgggatg
gttggctggatgatcactgcaagaactcccgaatacccgcgtggcaggcgcttcatcgtt
atcgccaacgatatcacattccaaattggatcttttggacctcaagaagataaatttttt
cataagtgcactgagcttgctaggaagcttgggatacctcgtatctacctttctgccaac
tccggtgctcgtatcggaatggcagaggagctgatgcatcacttctctgttgcgtggaat
gatccggagcgaccagaagctggattcaagtatctttaccttaccccggaagtgaagaag
agactagacgagaggaagacaaagaacgtcatcactgaacttgtcacggaaaacagtgag
gaaagacatatgattaccactgtcatcggtgcagaagacggccttggtgtcgagtgcctc
agaggctctggtctcattgctggcgccacctcgaaggcctacgaagacatcttcacgatt
acacttgtgacatgtcgttctgttgggattggtgcctacctcgttcgtctgggccagcgg
gcaattcaagttgaagggcagcctattatcctcaccggtgcccctgctatcaacaagctt
cttggaagagaagtctatacatccaacttgcagttgggtggaacacaaattatgtacaag
aatggtgtttcacacatgaccgcaaatgatgactttgaaggtattcagaagatcgtgcaa
tggatgtcatttatcccagacaagaagaattcgcctgtcccaattcgaccatattccgac
acttgggatcgagatatcggatattatcccccagccaggcaaccttacgatgttaggtgg
cttattgctggtaagcaggatgaagagggtttcttacctggtttcttcgacaaggattcc
ttccaggaaacactggctggatgggcgaggaccgtggttgtgggacgtgctagacttggt
ggaattcccattggcgtcatcgcagtggagacacgctctgtcgacactgtcacacctgcc
gaccctgccaatccagattcaatggagttgatttccacggaagccggtggagtttggtat
ccaaattctgcattcaagaccgcccaggctctcaaagattttaactttggcgaacagctc
cctgtgatgattcttgctaactggagagggttctctggtggtcaacgagacatgtacaac
gaagtactaaaatatggttcttatattgtcgacgcgcttgtcaaataccagcaacctgtt
tttgtttatatcccgccatttggggaactgcgtggtggttcctgggttgtgatcgatccc
accatcaacccagaacaaatggaaatgtacgctgatgaggagtcccgcggcggtgtcctt
gagccagaaggcatcgtcaatatcaaataccgtcgcgataagcagctggataccatggcc
cgtttggacccggaatacggcgagcttcgaaaagcactcaacgacaaatccctccccgct
gaccaactttccaagatcaaagccaagatgactgaaagagaagaacaactcctgccagtc
tacatgcaaatcgcccttcaatttgctgacctccatgaccgcgccggccgcatggaggcc
aaaggaaccatccgccaagccctccaatggaaaaatgcccggcggttcttttactggcgt
ctccgtcgccgtctcagcgaggaacttattctcaaacgcatggctgcagcctctccctcg
actgcttcgcgcaatagcgctgtcccgaacattaatgccaccagcccttcttcccccctc
aaacccaccacgccgtcaagacgtgatgccaatctaaatactctccaatcgtggactgga
atgctggatcgggagttcgacttcaatgatcgcaaggttgctctgtggtacgaagagaat
aaaaagaaggtgctggagaatgttgagcagatgaaggttgatggagttgcaattgaagtt
gcccagttacttatgggtaacaaggatggtgggttgaggggtgtgcagcaggtacttagc
atgctgcccgtggaggaaagggaggctgtattgaaatatttggggtcgccttga

DBGET integrated database retrieval system