KEGG   Paracoccidioides lutzii Pb01: PAAG_08731Help
Entry
PAAG_08731        CDS       T02230                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PAAG_08731
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PAAG_08731
   00640 Propanoate metabolism
    PAAG_08731
  Lipid metabolism
   00061 Fatty acid biosynthesis
    PAAG_08731
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    PAAG_08731
Enzymes [BR:pbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     PAAG_08731
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     PAAG_08731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 2297 aa AA seqDB search
MGVTVTPSTATNGFGSSFAAKHNLPSHFIGGNRLDLAPPGKVKDFVAKNDGHSVITSVLI
ANNGIAAVKEIRDVRKWAYNTFGDERAIQFTVMATPEDLRANADYIRMADQYVEVPGGTN
NNNYANVELIVDIAERMGVHAVWAGWGHASENPKLPESLAASPKKIIFIGPPGSAMRSLG
DKISSTIVAQHAGVPCIPWSGEGIDDVTIDEDGIVTVEDHIYDKGCTHSPQEGLEKARII
GFPVMVKASEGGGGKGIRKVDREEDFINLYNAAASEIPGSPIFIMKLAGNARHLEVQLLA
DQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPETFRAMERAAVRLGKLVGYVSAGTVE
YLYSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVD
PNTSSEIDFHFENEESTKTQRRPKPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSN
VWGYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIK
LLETPAFEDNTITTGWLDQLISNKLTAERPDPMIAVICGAVTRAHLSSEACIAEYRKGIE
KGQVPSKDVLKTVFPVDFIYEGFRYKFTATRSSNDNYHLFINGSKCSVGVRALADGGLLV
LLDGRSHNVYWKEEAAATRLSVDGKTCLLEEENDPTQLRTPSPGKLVKYTVENGEHVKAG
QPFAEVEVMKMYMPLIAKEDGIVQLIKQPGSTLEAGDILGILALDNPSRVKHAQPFLGQL
PDLGPPQVVGNKPPQRFGLLHNILWDILRGFDNQVIMGATLKELVEVLRNPELPYGEWNA
QVSALHSRMPQKLDSLLAQVVDRAKTRKAEFPANQLMKTLSRFIDENVTPADADILRTSL
QPLVDVIRRYSEGLKVHEYKVFIGILQQYWDVEHLFAGRNMRDEDVILKLREENKDDIFG
VIQTVLSHSKVGAKNNLLLAILDMYRPNKLNAGNVGNYLKPILKKLAELESRATSKVALK
AREVLIQCALPSLEERVAQMEHILRSSVVESKYGETGWDHREPDINVLKEVVDSKYTVFD
VLPLFFGHQDQWVSLAALEVYVRRAYRAYKLKGIEYHNQHESPFFISWDFTLGKAGGQSD
FGMVAGSSHPSTPTTPTMESNPFKKISSISDMSYLVNKGVNEPMRKGVIIPVNYLDDAEE
MLSRALEVFPRAESQKSSGNSIGLSLAALRKPTRVESIDELTGVCNVAIRDIEDLDDTEM
VSRITKLVSEVKEELLVRRVRRLTFICGHKDGTYPGYFTFRGPTYDEDESIRHSEPALAF
QLELGRLSKFRIKPVFTENRNIHVYEAIGKGPESDKAVDKRYFTRAVVRPGRLRDDIPTV
EYLISEADNLMNDILDALEIIGNNNSDLNHIFINFTPVFPLQPVDVERALAGFLERFGRR
LWRLRVTGAEIRILCTEPTTGMAYPLRVVINNTSGYIIQVEMYAERKSEKGEWIFQSIGG
TTKIGSMHLRPVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNCWTKASEEHS
SLADKRPAVGECIDYNELVLDDSDNLIEVAREPGTNTHGMVGWMITARTPEYPRGRRFIV
IANDITFQIGSFGPQEDKFFHKCTELARKLGIPRIYLSANSGARIGMAEELMHHFSVAWN
DPERPEAGFKYLYLTPEVKKRLDERKTKNVITELVTENSEERHMITTVIGAEDGLGVECL
RGSGLIAGATSKAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKL
LGREVYTSNLQLGGTQIMYKNGVSHMTANDDFEGIQKIVQWMSFIPDKKNSPVPIRPYSD
TWDRDIGYYPPARQPYDVRWLIAGKQDEEGFLPGFFDKDSFQETLAGWARTVVVGRARLG
GIPIGVIAVETRSVDTVTPADPANPDSMELISTEAGGVWYPNSAFKTAQALKDFNFGEQL
PVMILANWRGFSGGQRDMYNEVLKYGSYIVDALVKYQQPVFVYIPPFGELRGGSWVVIDP
TINPEQMEMYADEESRGGVLEPEGIVNIKYRRDKQLDTMARLDPEYGELRKALNDKSLPA
DQLSKIKAKMTEREEQLLPVYMQIALQFADLHDRAGRMEAKGTIRQALQWKNARRFFYWR
LRRRLSEELILKRMAAASPSTASRNSAVPNINATSPSSPLKPTTPSRRDANLNTLQSWTG
MLDREFDFNDRKVALWYEENKKKVLENVEQMKVDGVAIEVAQLLMGNKDGGLRGVQQVLS
MLPVEEREAVLKYLGSP
NT seq 6894 nt NT seq  +upstreamnt  +downstreamnt
atgggggttacagtcacaccttcgaccgccacgaatggctttgggagctcattcgcagca
aaacataacttaccgtcacactttatcggaggcaatcgcctagatcttgcacctccgggg
aaagtgaaggactttgttgcgaagaatgatggtcattcagtaattacttcggttcttatc
gcaaataatggcattgctgccgtcaaagaaattcgagatgtccgaaaatgggcctataat
acatttggcgatgagcgggcaattcagtttacggtcatggctacaccggaggatttaaga
gcgaatgcagactatattcggatggcagaccaatatgttgaggtccccggaggcacaaat
aacaacaattatgctaatgtagaactgattgtggacattgcggagcgtatgggtgttcat
gctgtttgggcaggatggggccatgcttcagaaaacccaaagctgccagaatcgcttgct
gcatctccgaaaaagataatttttattggccctcccggttctgcaatgcgatctcttgga
gataagatttcttccaccatcgttgcgcaacacgccggagttccctgcattccttggtcc
ggagaaggtatagatgatgttacaatcgatgaagatggtatcgtgaccgtcgaggaccat
atttatgacaaaggatgcacacattctccgcaagaagggcttgaaaaagctaggattata
ggttttcccgtcatggtcaaggcatcggaaggaggaggtgggaagggtattcggaaagtt
gatagagaagaggatttcatcaacttgtataatgccgcggcgagcgagattcccggatcc
ccaatcttcatcatgaaattagcgggtaacgcgagacatttggaggttcagttattggcc
gatcaatatggaaacaatatctctctgtttggtcgtgattgttcggtacagagacggcac
cagaaaattatcgaggaggcccctgtcactattgcaaagccggagacatttcgagcaatg
gagcgagccgctgtgaggcttgggaagttggttggctacgtttctgcaggaacggttgaa
tacctctattcccatgcggatgacaagttttatttcctggagcttaacccccgtctgcaa
gtcgaacatcccacaacagaaatggtttctggcgtgaatctcccagctgctcagctccag
attgccatgggaattccactacaccgcattcgcgatattcgtcttctttacggcgtggat
cccaacaccagctccgaaatcgacttccattttgaaaatgaggagagtaccaagactcaa
cgccgaccaaaaccaaaaggccacacaactgcttgtcgtatcacttccgaagatcctggt
gaaggcttcaagccatccagcggaacaatgcacgaactcaactttcgaagcagctctaat
gtctggggttacttctctgttggtaccgctggtggaattcacagcttctccgattctcaa
ttcggccatatctttgcctacggtgagaatcgctctgcttcgcgaaagcacatggtcgtt
gcactgaaggagttgagcattcgaggcgatttccggacaaccgttgagtatctcatcaaa
ctacttgagacacccgcttttgaggacaataccatcacgactggttggttggatcagttg
atttccaataagctgacggctgaacggccagatccaatgatcgctgtgatctgcggagct
gttactagggctcatctttctagcgaggcgtgtatcgcggagtaccggaagggcattgag
aagggtcaagtaccttccaaagatgttttgaaaacggttttccctgtcgattttatttac
gaaggattccgatataaattcacggccacgagatcaagtaacgataactatcatctcttc
attaatgggtccaaatgctccgttggggttcgagctcttgctgatggcggattgcttgtt
cttttggacggacgaagccataatgtttattggaaggaggaagccgctgcaactcgtctg
agtgtcgatggcaaaacatgtctgctcgaggaggagaatgaccccacacaactccgcaca
ccgagccctggaaagctggtcaagtacactgtggaaaatggggagcatgttaaagccgga
caaccattcgctgaggtcgaggtcatgaagatgtacatgccactcatcgccaaagaggat
ggaattgtccaactgataaagcaacctggatctactctcgaagctggagatattctgggt
attctcgcattagacaatccatccagagtgaaacacgcgcagccattccttgggcagtta
ccagatttaggccccccgcaagtcgtcggtaataagcctccccaacgatttggcttgctg
cacaatatcttgtgggatattctccgtgggtttgacaaccaagtcatcatgggagccact
ttgaaagagttggttgaagttttgcggaaccccgaacttccctatggagagtggaacgct
caagtctcagcccttcactcacggatgccacagaagctcgattccctacttgcacaagtt
gttgacagagccaaaacgcgaaaggcggagttccctgccaaccagttgatgaagacactt
agccgcttcatcgatgaaaatgttacacctgccgacgctgatattctccgcacaagtctc
caacctctcgtggatgtcattcgacggtatagtgagggattgaaagtccatgaatataaa
gttttcattggcattcttcaacagtactgggacgttgaacacctattcgcaggccgaaat
atgcgcgacgaagatgtgatccttaaactaagagaggagaacaaagatgacatttttggt
gtcatacaaacggttttgtcccacagcaaggtcggggcgaagaacaatttgctcttagcg
attttggatatgtatcgccccaacaaattgaatgccggcaacgtggggaactatttgaaa
cctatcctaaagaagctggcagagctggaatcccgcgcaacttctaaagtcgcgctgaaa
gcccgcgaagttcttatccagtgcgctcttccatccctggaggagagggtcgcccagatg
gagcatatcctgcgatcttcagtggtggaatcgaaatacggagagaccggctgggatcat
agagagcctgacatcaatgtcttgaaagaagtggttgactcgaagtacactgtctttgac
gttctccctctgttcttcgggcatcaggaccaatgggtatccctggcagcgctcgaggtg
tatgtccgccgtgcctatcgagcgtataaattgaagggtatcgaatatcacaaccagcac
gagagtccgttctttatttcctgggatttcactctcggaaaggctggtggccaatctgat
tttggaatggtggccggttcatctcacccgtccactcccaccacgcccacgatggaaagc
aatccgttcaagaaaatcagctccattagtgacatgtcatacttagttaacaaaggggtc
aatgagccaatgaggaaaggtgttatcattcccgttaattatctcgatgatgccgaggag
atgctttcgagggcactggaggtttttccccgcgcagagtctcagaagagcagcggaaac
tccattggcctatctttagcggctttgcgcaagccaacacgtgttgaaagcatcgacgag
cttactggcgtttgcaacgttgcgatccgtgatatcgaggaccttgatgatacggagatg
gtgtcgcgcattaccaagcttgtctctgaagtcaaagaagagcttctcgttcgtcgggtg
agaagacttacatttatctgcgggcataaggatgggacttatcctggttattttacgttc
agaggacctacttacgacgaagatgagagcattcgacacagtgaacctgcacttgcattc
caactggaattgggaaggctttccaaatttagaattaagcctgtctttacggaaaatcgg
aatattcacgtttacgaggcaattggaaaggggccggagagtgacaaggctgttgataaa
cgttatttcacgagagctgttgttcgcccgggccgattgcgagatgatattcccacggtg
gagtatcttatctctgaggctgacaacttaatgaatgacatcctggatgctctggaaatt
attggcaataacaactctgatttgaatcatatctttatcaactttacgcccgtttttccc
cttcagccggttgatgtcgaaagggccttggcaggctttttggaacgctttggtcgacga
ctctggcgcctccgcgtcactggagctgaaatccgtatcctctgcacggagccgacgact
ggaatggcctatcccctccgtgtagttatcaataacacctcaggatacattattcaagtt
gaaatgtatgctgagcgaaagtccgagaaaggggaatggatattccagagcatcggtggc
acgacaaaaataggatccatgcatcttcgtccagtttcaacaccgtatcccacgaaggaa
tggctgcaacccaaacgatataaggcccatttaatgggtactcaatacgtctacgacttc
ccggagctattcagacaggcttttcagaactgctggacaaaggctagtgaagagcattct
tccctcgctgacaaacggcctgctgtgggcgagtgtatcgactacaacgaactcgtgctt
gatgattctgacaatttaatcgaggtcgcgcgagagcctgggaccaatacgcatgggatg
gttggctggatgatcactgcaagaactcccgaatacccgcgtggcaggcgcttcatcgtt
atcgccaacgatatcacattccaaattggatcttttggacctcaagaagataaatttttt
cataagtgcactgagcttgctaggaagcttgggatacctcgtatctacctttctgccaac
tccggtgctcgtatcggaatggcagaggagctgatgcatcacttctctgttgcgtggaat
gatccggagcgaccagaagctggattcaagtatctttaccttaccccggaagtgaagaag
agactagacgagaggaagacaaagaacgtcatcactgaacttgtcacggaaaacagtgag
gaaagacatatgattaccactgtcatcggtgcagaagacggccttggtgtcgagtgcctc
agaggctctggtctcattgctggcgccacctcgaaggcctacgaagacatcttcacgatt
acacttgtgacatgtcgttctgttgggattggtgcctacctcgttcgtctgggccagcgg
gcaattcaagttgaagggcagcctattatcctcaccggtgcccctgctatcaacaagctt
cttggaagagaagtctatacatccaacttgcagttgggtggaacacaaattatgtacaag
aatggtgtttcacacatgaccgcaaatgatgactttgaaggtattcagaagatcgtgcaa
tggatgtcatttatcccagacaagaagaattcgcctgtcccaattcgaccatattccgac
acttgggatcgagatatcggatattatcccccagccaggcaaccttacgatgttaggtgg
cttattgctggtaagcaggatgaagagggtttcttacctggtttcttcgacaaggattcc
ttccaggaaacactggctggatgggcgaggaccgtggttgtgggacgtgctagacttggt
ggaattcccattggcgtcatcgcagtggagacacgctctgtcgacactgtcacacctgcc
gaccctgccaatccagattcaatggagttgatttccacggaagccggtggagtttggtat
ccaaattctgcattcaagaccgcccaggctctcaaagattttaactttggcgaacagctc
cctgtgatgattcttgctaactggagagggttctctggtggtcaacgagacatgtacaac
gaagtactaaaatatggttcttatattgtcgacgcgcttgtcaaataccagcaacctgtt
tttgtttatatcccgccatttggggaactgcgtggtggttcctgggttgtgatcgatccc
accatcaacccagaacaaatggaaatgtacgctgatgaggagtcccgcggcggtgtcctt
gagccagaaggcatcgtcaatatcaaataccgtcgcgataagcagctggataccatggcc
cgtttggacccggaatacggcgagcttcgaaaagcactcaacgacaaatccctccccgct
gaccaactttccaagatcaaagccaagatgactgaaagagaagaacaactcctgccagtc
tacatgcaaatcgcccttcaatttgctgacctccatgaccgcgccggccgcatggaggcc
aaaggaaccatccgccaagccctccaatggaaaaatgcccggcggttcttttactggcgt
ctccgtcgccgtctcagcgaggaacttattctcaaacgcatggctgcagcctctccctcg
actgcttcgcgcaatagcgctgtcccgaacattaatgccaccagcccttcttcccccctc
aaacccaccacgccgtcaagacgtgatgccaatctaaatactctccaatcgtggactgga
atgctggatcgggagttcgacttcaatgatcgcaaggttgctctgtggtacgaagagaat
aaaaagaaggtgctggagaatgttgagcagatgaaggttgatggagttgcaattgaagtt
gcccagttacttatgggtaacaaggatggtgggttgaggggtgtgcagcaggtacttagc
atgctgcccgtggaggaaagggaggctgtattgaaatatttggggtcgccttga

DBGET integrated database retrieval system