KEGG   Paracoccidioides lutzii Pb01: PAAG_08837Help
Entry
PAAG_08837        CDS       T02230                                 

Definition
(RefSeq) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PAAG_08837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 246 aa AA seqDB search
MAWQSSGKSNAQLINNLFKNGLIKHERVRDAMLAVDRGDYCPANPYADSPQGIGYAATIS
APHMHVHACEYLLPFLRPDSRVLDIGSGSGYLTHVFANLITGTSTTGTPPSNGTVVGIDH
IQGLVDMATINMAKSESGLQLLNSGKARFVLGDGRKGYPEGGPYDAIHVGAAAAVMHPAL
IEQLRAPGRMFIPVESGGESGMRSFGLGGSQYIWVVDKKEDGTVVKDKIFGVSYVPLTDA
PKARRE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcagagttcgggaaaatctaacgcgcagttgattaataatttgttcaagaat
ggtcttattaaacatgagagagtaagagatgctatgcttgcagtcgaccgcggcgactac
tgccccgcaaacccctacgcagactccccacaaggaatcggctatgctgccacaatctct
gcaccgcacatgcacgtccatgcctgcgaatacctcctcccattcctgcgtccagactcg
cgtgtcctggacataggctccggctccggttatctaactcacgtctttgccaatctcatt
actggcacctccaccaccggcaccccaccttcaaatggcacagtcgttggcatcgaccac
atacaagggctggtcgacatggccactataaatatggccaaatcagaatcgggcctccag
ctcctcaactctggtaaagcgcgctttgtccttggcgatgggagaaaaggttaccctgag
gggggaccctatgatgccattcacgttggtgcggcagcggcggtaatgcacccagcctta
attgagcagctgcgtgcgcctgggaggatgtttatccccgtggaatcgggaggggagagc
gggatgagatcctttggccttggtggctcacaatatatctgggttgtggataagaaggag
gatgggactgtggttaaggataaaatttttggtgttagttatgtcccgttgacggatgcc
ccgaaggcaaggagggagtga

DBGET integrated database retrieval system