KEGG   Paracoccidioides brasiliensis: PAAG_08837Help
Entry
PAAG_08837        CDS       T02230                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 252 aa AA seqDB search
MAWQSSGKSNAQLINNLFKNGLIKHERVRDAMLAPNGPIQVDRGDYCPANPYADSPQGIG
YAATISAPHMHVHACEYLLPFLRPDSRVLDIGSGSGYLTHVFANLITGTSTTGTPPSNGT
VVGIDHIQGLVDMATINMAKSESGLQLLNSGKARFVLGDGRKGYPEGGPYDAIHVGAAAA
VMHPALIEQLRAPGRMFIPVESGGESGMRSFGLGGSQYIWVVDKKEDGTVVKDKIFGVSY
VPLTDAPKARRE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcagagttcgggaaaatctaacgcgcagttgattaataatttgttcaagaat
ggtcttattaaacatgagagagtaagagatgctatgcttgcaccaaacggccccatccag
gtcgaccgcggcgactactgccccgcaaacccctacgcagactccccacaaggaatcggc
tatgctgccacaatctctgcaccgcacatgcacgtccatgcctgcgaatacctcctccca
ttcctgcgtccagactcgcgtgtcctggacataggctccggctccggttatctaactcac
gtctttgccaatctcattactggcacctccaccaccggcaccccaccttcaaatggcaca
gtcgttggcatcgaccacatacaagggctggtcgacatggccactataaatatggccaaa
tcagaatcgggcctccagctcctcaactctggtaaagcgcgctttgtccttggcgatggg
agaaaaggttaccctgaggggggaccctatgatgccattcacgttggtgcggcagcggcg
gtaatgcacccagccttaattgagcagctgcgtgcgcctgggaggatgtttatccccgtg
gaatcgggaggggagagcgggatgagatcctttggccttggtggctcacaatatatctgg
gttgtggataagaaggaggatgggactgtggttaaggataaaatttttggtgttagttat
gtcccgttgacggatgccccgaaggcaaggagggagtga

DBGET integrated database retrieval system