KEGG   Paracoccidioides brasiliensis: PAAG_08902Help
Entry
PAAG_08902        CDS       T02230                                 

Definition
L-asparaginase
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
pbl  Paracoccidioides brasiliensis
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PAAG_08902
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     PAAG_08902
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     PAAG_08902
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 542 aa AA seqDB search
MTGTVEPMQNGQGLSLRPESRVLIIMTGGTICMQRSDSGFIPAHGFQKAALEPFPTFNDN
SNPEPLDVVVNASGERKPYASLRTPLTSYGGHIRYTVFEFEQLLDSSSIDAKGWAEIAHT
ISWNYTLFDAFVVLHGTDSLAYTCSALSFMLRNLGKPVILTGSQAPMLELQSDATDNLLG
SLVIAGHFMIPEICLYFNYKLLRGNRATKVSASSFAAFDSPNFLPLAVTTAMGTNVAWDL
VLRPTNIEHFSIQTNLDTTHVACLRIFPGIKPEMVDAVLRLEGLRGLVLETYGAGNAPGG
QDNAMTNVLAAAILRGIVIVNVTQCLSGAVSPVYAPGMNLYRAGVVAGQDMTTEAALTKL
AYLLALPGATPETVARDMSISLRGELTEQSQTIFRHPDGVLRERIKSLTAVAYAIAQGNL
DKVKDILRGEKQWILNDADYLGNTPLHLAATSPNLAILRHFLLHGGSVHLRNRAGRTALF
LAANAGLADHVMLLRESGAHLHADELGVAELHARRRAGMGTGMSVWSLAGVEVEGKAEEK
VD
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaacagtggaaccaatgcaaaatggacagggtctgtcactccgcccagaatcc
cgggtcttgataatcatgacaggcgggacgatatgcatgcagcgttcagattccggcttc
attccagctcacggctttcaaaaggccgccttggaaccctttccgactttcaatgacaac
tctaacccggaacccctcgacgtcgtcgtaaacgcttctggcgaacggaagccctatgct
agcctccgtactcccctaacatcctacggcggtcatattcgttacacagtcttcgaattt
gaacagttgctcgacagcagctccatcgacgcaaaggggtgggcggaaatcgcccacacc
atttcgtggaactacacactgttcgatgcctttgtcgtcctgcatggtaccgacagtttg
gcttacacttgttctgcgctgagcttcatgctgcgcaacctaggcaagccagttatattg
accggttcccaggcaccaatgctggagctgcagagcgatgcaacagacaatctactcggt
tccttagtgatcgcgggccacttcatgattccggaaatctgcctatatttcaattacaaa
ctactacggggaaaccgggcaacgaaggtatctgcaagctcatttgcggcttttgattcg
cccaatttcctgccgctggctgtcactacggcgatgggcacgaacgtcgcatgggatctt
gtgttaagaccgacgaacattgagcattttagcatccaaacgaacttggatacgacgcat
gtggcgtgtttgagaatcttccctggaatcaaaccggagatggtggatgcggtgttgaga
ttggaagggttgaggggcctcgtgttagagacgtatggagcaggaaatgcacctggtggg
caggacaatgcaatgacgaatgtactggccgctgcgattctgcgtgggattgtgattgtg
aatgttacacagtgtctatccggcgcagtcagccccgtttatgccccgggaatgaacctc
taccgcgctggagtcgtcgcgggccaagatatgaccaccgaagctgcgttgaccaaactt
gcctaccttcttgcacttcccggggcgacgcctgagaccgtcgcacgagacatgtccatt
tccctccgtggggaacttaccgagcaatcacagaccatatttcgacatccggacggtgtg
cttcgggaacgaattaagagcctaactgccgtagcctatgcgattgctcagggaaatctt
gacaaggtgaaagatatcctgcgcggggagaaacagtggattttgaacgatgcagattat
ttggggaatactccattgcatctcgcggcaacctctcccaacctcgccattctacgacac
ttcctcctccatggcggatctgtccatttacgaaaccgtgcgggccgaacagctctattc
ctcgctgcaaacgcggggttggctgatcatgtcatgctgctgcgggaatcaggagcccat
ttgcatgctgatgagttaggtgtggcggagttgcatgcgagacggcgggcgggcatgggt
acgggtatgagtgtatggtcgctagcgggcgttgaagtggaagggaaggcggaggaaaag
gtggattga

DBGET integrated database retrieval system