KEGG   Paracoccidioides brasiliensis: PAAG_08913Help
Entry
PAAG_08913        CDS       T02230                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pbl  Paracoccidioides brasiliensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAAG_08913
   00670 One carbon pool by folate
    PAAG_08913
Enzymes [BR:pbl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PAAG_08913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 362 aa AA seqDB search
MLSSSITPFSTTMSPTTTLTTSARPLLHTPSPLTLIVATTPITMSTLNANAPSNFTRRCL
GIGHAGTLPWPSIKADMKFFSRVTTHAPPHSLPSSLDSTGTGRAVNAVNAVIMGRRTYDS
LPTRFRPLPGRVNVVVTRDGSGKEKERIEGEWRAMRERERERKRRGDGLSASGGDTSTST
TIVKNDIETPDILIANSLESAVTALYDAFQTSTDDSYAVLPGPLSHNSTRYLANTFVIGG
SEIYASALNLDCKLDAGVPDGQRQGIRIVMTDIRRFPAALNDATDDGATATSVNGVEDSV
NGFECDTFFPLDEDELERGDGEWRRVSSQEVSGWVGVEVKEGWVQEGEVALRILGFERRG
VR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctctcatcctctatcacccccttctcaaccacaatgtcaccaacaaccacccttacc
acctccgcccgccctctcctacacaccccctcccctctaaccctcatcgttgctacaacc
ccgataacaatgtccactctcaatgctaatgctccttctaacttcacacgccgctgccta
ggtatcggccatgcgggcacccttccttggcccagcattaaagcagacatgaaattcttc
tcacgagtcacaacccatgcgcctccccactcattgccatcatcactagacagcacaggc
acaggaagggccgtgaatgctgtaaatgcagtaattatggggcgaagaacatatgactca
cttcccacgcgctttcggccgctgccgggccgtgtgaatgttgtcgtgacgcgggatggg
tcagggaaagagaaggagaggattgagggggagtggagggcaatgagggagagggaaagg
gagaggaagaggagaggagatggtttgagtgctagtggtggtgatacatctacatctacg
acaatagttaagaatgatattgaaacccccgatatccttatagcgaatagtctcgagtca
gctgtgacagcactttatgatgcattccaaaccagtactgatgacagctatgctgtactc
cccggacccctctcccacaactccacccgctacctcgcaaataccttcgtaattggcggc
agtgagatatacgcctctgctcttaaccttgactgcaagctggatgccggtgttcctgat
ggccaaagacaaggtatcaggattgtcatgacagatataaggcgatttcctgctgcattg
aatgatgctactgatgatggagctacagcaacctcagtgaatggagtggaggactctgtg
aacggttttgaatgtgatacatttttcccacttgatgaggatgaactggagcgcggagat
ggagagtggaggagggtgagcagccaggaggtttccgggtgggttggggtggaggtgaag
gaggggtgggtgcaggaaggggaggttgcgttgaggatcctggggtttgagaggaggggg
gtgagatag

DBGET integrated database retrieval system