KEGG   Paracoccidioides lutzii Pb01: PAAG_08915Help
Entry
PAAG_08915        CDS       T02230                                 

Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAAG_08915
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAAG_08915
  Amino acid metabolism
   00310 Lysine degradation
    PAAG_08915
Enzymes [BR:pbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PAAG_08915
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 473 aa AA seqDB search
MAPRLQISQQMSRNLRLIPRHVCTGSNRSQISCRAVSSISHLSQSKGSLGPSQTIIPLSS
PAPLRHVITLSNTLFIGSQRRTYADSIVKVPQMAESISEGTLKQFSKKVGDYVERDEELA
TIETDKIDVTVNAPDAGTIKELLANEEDTVTVGQDLIKLETSSATPEKTKEEKQPAKQEE
KTEASRHPPPSQPKQVPSPLPKPEQATENPARPKHNPSKPEPAQTSQPAPGNREERRVKM
NRMRLRIAERLKQSQNTAASLTTFNEVDMSSLMEFRKLYKEGVLKKTGVKLGFMSAFSRA
CVLAMRDVPTVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESLELIGIEK
AIAELGKKACKEFCPARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHA
IKDKPVVVDGKIEIRPMMYLALTYDHRLLDGREAVTFLIKEYIEDPRPFQYVY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggctccacggctacaaatctcgcaacaaatgtcgaggaatttgcgactcatccccaga
catgtctgtaccggctcgaatcgatcccaaatctcctgcagggctgtgtcgtccattagc
catttgtcgcaatccaagggcagtctgggaccttcccagaccatcatccccttgagttct
ccagctcctctgagacacgtaattaccctatcgaatacgttgtttatcggcagtcagaga
cggacctatgcggattcaattgtcaaagtgccgcagatggcagaatcgatatcggaagga
acattaaaacagttctcgaaaaaggtcggagactatgttgaacgggacgaggaacttgca
actatcgaaacagacaagatcgacgtcaccgtcaatgcaccagatgctggcacgattaag
gagcttcttgcaaatgaagaggatactgttacagttggccaagacctcatcaaactggag
actagtagcgctactccggagaaaacaaaagaagaaaagcagcccgcgaaacaagaggaa
aagactgaagcttctcgtcaccctcctccgtcacagccaaagcaggttccttctcccctt
ccaaaaccagagcaagccactgaaaatcccgcccggccaaagcacaacccgtccaaacct
gaacccgcccaaacatcgcagccggcccccggaaacagggaagaacgcagggtaaaaatg
aaccgtatgcgcctgcgaattgccgagcgtctgaagcagtctcagaatactgcagcatcg
ctcaccacattcaacgaggttgacatgtcgtctctcatggaattccgtaaactctacaag
gagggtgtcttgaagaagaccggcgtaaagttgggctttatgagcgctttctctcgtgcg
tgtgttttggctatgagagatgtccctactgtcaacgcctcgattgaggggccgaacggc
ggtgatacgatcgtctatagagactatgtcgatatcagcgttgcagtggcgacggagaaa
ggattggtgactccagtggtgcgaaacgctgagtccctggaacttattggaattgagaag
gcaattgcagaattgggtaaaaaggcatgtaaagagttctgtcctgcgcgtgataataaa
ttgaccattgaagacatggccggtggcacattcactattagcaatggtggcgttttcggg
tccctcatgggcacacccatcatcaaccttcctcaaacagctgtgctcggtcttcatgcc
atcaaggataaaccagtcgttgtcgatggaaaaatcgagattagacctatgatgtatctt
gctttgacctatgaccatcgtctactagatggtcgagaagctgtgacattccttattaag
gaatatatcgaagatccaagacccttccagtatgtatattag

DBGET integrated database retrieval system