KEGG   Paracoccidioides brasiliensis: PAAG_08918Help
Entry
PAAG_08918        CDS       T02230                                 

Definition
late histone H2B.L4
Orthology
K11252  
histone H2B
Organism
pbl  Paracoccidioides brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 141 aa AA seqDB search
MPPKAAEKKPSTAGKAPVGGKAPAEKKEAGKKTAAAAGGEKKKRTKTRKETYSSYIYKVL
KQVHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGE
LAKHAVSEGTKAVTKYSSSAK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagccgccgagaagaagcccagcaccgcaggcaaggctccagttggaggc
aaagcccccgccgagaagaaagaggctggcaagaagactgccgctgctgctggtggtgag
aagaagaagcgcaccaagaccagaaaggaaacctactcctcctacatctacaaagttctg
aagcaagtccaccctgatactggtatctcaaaccgtgcaatgtccatcctcaactctttc
gtcaatgacattttcgagcgtgtggccactgaagcctccaagctcgctgcctacaacaag
aaatccacaatctcttccagagaaatccagacctctgtgagacttatcctccccggtgaa
ctggcaaaacacgccgtctccgaaggcacaaaggccgtcaccaagtactcttcatccgcc
aaataa

DBGET integrated database retrieval system