KEGG   Paracoccidioides lutzii Pb01: PAAG_08925Help
Entry
PAAG_08925        CDS       T02230                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
  KO
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pbl  Paracoccidioides lutzii Pb01
Brite
Enzymes [BR:pbl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PAAG_08925
Peptidases [BR:pbl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PAAG_08925
Ubiquitin system [BR:pbl04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    PAAG_08925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 417 aa AA seqDB search
MTDRTKRRRLNSPKSFESLPLQPLTPSDKANWHGFCEIESEPALFNVMLRDFGVKGVKVQ
EVVSLDDEMLEFLHKPVYGLIFLFRWKEDDPEKQESSCPEGIWFANQTSNYACASVALLN
IINNVDGIELGEKLQHFKDFTMPFTPALRGDAIGNFEFVKRVHNSFARKMDVLSTDMQLK
TEAMKRKSRGKKSKSQDIDDTESVFHFIGFVPARGKLWKFDGLERQPQNLGECSGDKWLD
LAKPEILSRMAEYEEDQIEFSILGLVKDPLIDLKTQLAENIKCIFAIDNQLSTLGLSSLD
DATATAVKGNNANGNGNRHDSFINITQEEMERAGVPEDLRTKYKSATPEELTSYREELVS
AQKGIRILISEEQQSQRADEDYAAARRHDYGPAVHTWVRLLARKKVIQGLVSEMQAY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccgaacaaaacgccggcggcttaattcgccaaagtcttttgagagtttgccc
ctccagcctttgaccccgtctgataaagccaactggcatggcttttgcgaaattgaatca
gagccggctctgttcaatgtcatgctgcgagattttggtgtcaaaggggttaaagtccag
gaggtggtgtctctggatgacgagatgctagaatttcttcacaaaccagtctatgggctt
atctttctctttcgctggaaggaagatgatcctgaaaaacaggagtcaagctgccctgag
ggcatttggtttgctaatcaaacatctaactacgcctgcgcaagtgttgctctactaaac
attatcaacaacgtcgacggaatcgaactcggggagaaacttcagcattttaaggacttc
acaatgccttttacccctgcactgcgtggagatgcaatcggcaatttcgaatttgtcaag
cgagttcataactcgttcgcgaggaaaatggatgttctcagtaccgatatgcagttaaag
accgaggcaatgaaaagaaagtccaggggaaagaaatcaaaatcacaggatatcgatgat
actgagtccgtcttccatttcattggcttcgttccagcaaggggtaaactgtggaaattt
gatggcttagagcgccagccgcaaaatctaggcgaatgctcgggcgacaagtggttggat
ctagctaagccagaaatcctttcaaggatggcggaatacgaggaagatcaaatcgaattt
tccatcttgggccttgtaaaagaccctctaatcgacttgaaaacacagctagcggaaaac
atcaagtgtatcttcgccatagacaaccagctatctacactgggtctatcttctctggat
gatgccactgcaactgcagtcaagggtaacaacgcaaatggtaacggtaatcgccatgat
tcatttatcaacatcacccaggaagagatggaacgggcaggtgttccagaagatctcaga
accaaatataaatctgcaacaccagaggagttgaccagttatcgagaagagctcgtcagc
gcccaaaagggaatacgaattttgatcagcgaggaacagcaatcgcagcgagctgacgaa
gactacgcggcagcaagaaggcatgattacgggcctgctgtgcatacctgggtccgtctc
cttgctcgcaagaaggtgattcaagggttggttagtgaaatgcaagcgtattga

DBGET integrated database retrieval system