KEGG   Paracoccidioides brasiliensis: PAAG_09045Help
Entry
PAAG_09045        CDS       T02230                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
pbl  Paracoccidioides brasiliensis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PAAG_09045
Translation factors [BR:pbl03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    PAAG_09045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 240 aa AA seqDB search
MATTAENVVVIQSPVNDENFAPDAAAQTKSGDTVTVFHDPNNFNVKHPLMHDWTLWFTKP
PSGKGDNWNELLKEVVTFNSVEEFWGIYNNITPTSKLGLKADYHLFKKGVRPEWEDQQNK
HGGKWSYSFRDKQNVPIDELWLHAQLAAIGETLESDGDNEVMGVVVNVRKGFYRVGLWTR
TVGKSTPEGRPAEKGKEILLNIGRKFKEVLRLKDNEILEFSGHTDSAHAGSTRAKAKFSV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggctaccacggcagagaatgtggtcgtgatccaaagccccgtaaatgatgagaatttt
gctcccgatgcagctgctcagacaaaatcgggcgacaccgtcactgtcttccatgatcca
aacaacttcaatgtcaaacacccgttgatgcatgattggacactctggtttacaaaaccg
ccaagtgggaagggcgacaattggaacgaacttctcaaggaggttgtgacatttaactca
gtggaggaattctggggaatttacaacaacatcactcccacctccaaactaggcctgaaa
gcagattaccacctctttaaaaagggtgtccgtcccgaatgggaagaccagcaaaataag
cacggtggtaaatggtcgtactccttccgcgataagcaaaacgttcccatcgacgagctc
tggctgcacgcccagctcgctgccatcggcgaaaccctcgagagcgacggtgataacgaa
gttatgggcgtagtcgtcaacgtacgcaagggtttctacagagtcggcctgtggacccgg
actgtcggcaagagcacaccagagggccgtcctgcagagaagggcaaagaaattctgctt
aatattggcaggaagtttaaggaggtgctacgcctaaaagacaatgagattttggagttt
tcgggccataccgatagtgcccatgcggggagtacgagggcgaaggctaagttttctgtt
tga

DBGET integrated database retrieval system