KEGG   Propionibacterium acidipropionici: PACID_00180Help
Entry
PACID_00180       CDS       T02345                                 

Definition
ribokinase protein (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PACID_00180
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PACID_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23212..24141
Genome map
AA seq 309 aa AA seqDB search
MSQRIVVVGSVNADLRVTVERHPRPGETLLGGDGTVTPGGKGANQALAAARAGGNVTMIG
AVGHDPNAAAALDLLRGSGADLSGIAEVDGPTGVAVVMVAASGENEIVYIPGANATVGAD
AVASHAELLGQAAVVLCQGETPADGIARAQALAGGRLVLNPAPVIELPPEVITAADPLIV
NEHEGALVARMLDPDADVAALEEDPGGCVRALRAAGCRSVVMTLGSAGALVAEGDDVTAI
PAVRVDAVDTTGAGDAFAGALSARLAEGGTLLEACGYAARFAALTVTRTGAQASFPSAEE
VAGLRGEGR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcagcgcatcgtcgtcgtcgggtcggtcaacgccgacctgagagtcaccgtcgag
cgacatccccgaccgggggagacgctgctcggcggggacggcaccgtcaccccgggcggc
aagggggccaaccaggccctggccgccgcccgggcgggcggcaacgtcaccatgatcggg
gctgtgggccatgatccgaacgccgccgcggccctggatctgctgcgcgggtcgggcgcc
gacctgtcggggatcgccgaggtcgacggtcccaccggggtcgcggtggtgatggtggcc
gcatccggggagaacgagatcgtctacatccccggcgccaacgccaccgtcggcgccgat
gccgtcgcctcccacgccgagctgctgggccaggcagcggtcgtgctgtgtcagggggag
acccccgccgacggcatcgcccgagcccaggcccttgccggaggtcggctcgtgctcaac
ccggcaccggtgatcgagctgccgcccgaggtgatcacggccgccgatccgctgatcgtc
aacgagcatgagggggccctggtggcccggatgctcgatcccgatgccgacgtcgctgcg
ctggaggaggatcccggaggctgtgtccgggcattgcgggcggccggctgccgatccgtc
gtgatgaccctcggctcggcgggagcgctggtggccgagggcgacgacgtcaccgcgatt
ccggcagtcagggtcgacgcggtggacaccacgggggccggggacgccttcgccggcgcc
ctgtcggcgcggctcgccgagggcgggacactgctggaggcctgcggttacgcggcacga
ttcgccgcgctgaccgtcaccaggaccggcgcccaggcctccttcccgagcgccgaagag
gtggccgggctgaggggtgagggccgatga

DBGET integrated database retrieval system