KEGG   Propionibacterium acidipropionici: PACID_00880Help
Entry
PACID_00880       CDS       T02345                                 

Definition
L-ribulose-5-phosphate 4-epimerase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PACID_00880
Enzymes [BR:pbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PACID_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96143..96784)
Genome map
AA seq 213 aa AA seqDB search
MILEEERQAVVDACQEMQRKGLVVGTAGNVSVRVADRVCISPSAVEYEDLTAELVGVHDL
DGNVVEAQLKPSSELPLHLAVYHSTDAGGITHNHAPSSTALGLVCDEIPFSHYYSAMFGG
PVRVSPYADFGTDQLAHNVAEALQGRSGALMSNHGAITIGPTLDKALSLLPYLEYICEIQ
LRAMATGQPVKVLTDEQIAFQIEAIKGYKPAKA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattctcgaggaagaacgccaggctgtcgtcgacgcctgccaggagatgcagcgcaag
ggtctcgtggtcggcacagccggtaacgtgtcagtgcgcgtcgcagacagggtgtgcatc
tctccgtcagcggtggagtacgaggacctcaccgcagagctggtcggcgttcacgatctc
gacggcaatgtcgtcgaggcacagttgaagccctccagcgaactgcccctccacctggcc
gtttaccactccaccgatgccggcgggatcacccacaaccacgccccgtcgtccaccgca
cttggcctggtgtgtgacgagatccccttctcccactactactcggcgatgttcggcggc
ccggtccgcgtctccccctacgccgatttcggcaccgatcagctcgcccacaatgtcgcc
gaggcgcttcaagggcggtccggtgcgctgatgagcaaccacggcgccatcaccatcggg
ccgaccctcgacaaggcgctgtccctgctgccctacctggagtacatctgcgagatccag
ctccgtgcgatggccaccggtcagccggtgaaggtgctcacagacgagcagatcgccttc
cagatcgaggcgatcaaggggtataaacccgccaaggcctga

DBGET integrated database retrieval system