KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_00880Help
Entry
PACID_00880       CDS       T02345                                 

Definition
(GenBank) Putative L-ribulose-5-phosphate 4-epimerase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00051  Fructose and mannose metabolism
pbo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PACID_00880
Enzymes [BR:pbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PACID_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AFV87939
UniProt: K7RJ73
Position
complement(96143..96784)
Genome map
AA seq 213 aa AA seqDB search
MILEEERQAVVDACQEMQRKGLVVGTAGNVSVRVADRVCISPSAVEYEDLTAELVGVHDL
DGNVVEAQLKPSSELPLHLAVYHSTDAGGITHNHAPSSTALGLVCDEIPFSHYYSAMFGG
PVRVSPYADFGTDQLAHNVAEALQGRSGALMSNHGAITIGPTLDKALSLLPYLEYICEIQ
LRAMATGQPVKVLTDEQIAFQIEAIKGYKPAKA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattctcgaggaagaacgccaggctgtcgtcgacgcctgccaggagatgcagcgcaag
ggtctcgtggtcggcacagccggtaacgtgtcagtgcgcgtcgcagacagggtgtgcatc
tctccgtcagcggtggagtacgaggacctcaccgcagagctggtcggcgttcacgatctc
gacggcaatgtcgtcgaggcacagttgaagccctccagcgaactgcccctccacctggcc
gtttaccactccaccgatgccggcgggatcacccacaaccacgccccgtcgtccaccgca
cttggcctggtgtgtgacgagatccccttctcccactactactcggcgatgttcggcggc
ccggtccgcgtctccccctacgccgatttcggcaccgatcagctcgcccacaatgtcgcc
gaggcgcttcaagggcggtccggtgcgctgatgagcaaccacggcgccatcaccatcggg
ccgaccctcgacaaggcgctgtccctgctgccctacctggagtacatctgcgagatccag
ctccgtgcgatggccaccggtcagccggtgaaggtgctcacagacgagcagatcgccttc
cagatcgaggcgatcaaggggtataaacccgccaaggcctga

DBGET integrated database retrieval system