KEGG   Propionibacterium acidipropionici: PACID_03120Help
Entry
PACID_03120       CDS       T02345                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PACID_03120
  Lipid metabolism
   00561 Glycerolipid metabolism
    PACID_03120
   00600 Sphingolipid metabolism
    PACID_03120
Enzymes [BR:pbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PACID_03120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(337166..339319)
Genome map
AA seq 717 aa AA seqDB search
MKLDPRQTPIVHLRAGGTSLIVDTTPGTASTDTASQPVILAWGPDLGDLSEPALQAIRTA
STATVQAGELSDESRLGVIPLASSGWMGRPGLSGHRADGSGWSPRLVCTGADLEGSRVTY
QLLDVQAGLDVELVLEVLPQGLVRARAELTNTAPAPYFLDELSVALPLPLTATEILDFAG
RWGLERAPQRSTVEVGCHLRESRHGRPGFASPMAMFCGETGFSFERGRVWGLHVAHSGNG
RTWVARTSTGRQVIGGGELLLPGEIALGTGDSYRTPWIYGQCTEGLDDAARQLHRWERTL
PAHPDVERPVSLNVWEAVYFNHDLPTLTALAERAASIGVERFVLDDGWFKGRRNDRAGLG
DWTVDADVWPGGLHPLVDRVRELGMEFGLWVEPEMINPDSDLARAHPEWIMRARDELPAE
WRHQQVLNITIPAAWEYLHAAIGRLIDEYGIGYLKWDHNRDLIEAGDAGGRAVVHEQTLA
CYRLMDALRAEHPGLEIESCASGGGRIDLEMLTHVQRVWPSDCIDPHERQSIMRWTSQIA
AAEYLGSHIASPRSHTTGRVSDLSFRAGTALWGHLGFEWDLLAASEEDLAQLRQWVTLFK
AHRPNLFSGDIVRRDVADGSMWLHGVVAADRSSAMFQLATRERSPLSPRGMMPIPGLDPD
RTYRLQAVLVGDGPDGLVAPPWAAEGIELPGSVLGQVGVHTPLLNPDQVLILTVRAV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactggacccccgccagacgccgatcgtccacctgcgtgcgggcggcacatccctg
atcgtcgacacaacccccggcaccgcctccaccgacaccgcctcccagccggtgatcctg
gcctggggccccgatctcggcgacctgagcgagcccgccctgcaggccatccggacggcc
tcgaccgccaccgtccaggccggcgagctgagcgacgagtcgcgactcggcgtcatcccc
ctggcctcctccggatggatgggtcggcccgggctgtcgggccaccgcgccgacggatcg
gggtggtctccgcggctggtctgcaccggcgccgacctcgagggctcccgggtcacctac
cagctgctcgacgtccaggccggcctcgacgtcgagctcgtcctcgaggtgctcccccag
ggactcgtgcgcgcccgcgcggaactcaccaacaccgccccggccccctacttcctcgac
gaactgtcagtcgccctgccgctgcccctgacggccaccgagatcctcgacttcgccggc
cgctgggggctggaacgggcaccccagcggagcacggtggaggtgggctgccacctgcgc
gagagccgccacggccgccccggattcgcctccccgatggccatgttctgcggcgagacc
ggcttcagcttcgagcgcggccgggtctgggggctgcacgtcgcccactccggcaacggc
cgcacctgggtggcgcgcaccagcaccggccgccaggtgatcggcggcggggagctccta
ctgcccggcgagatcgccctgggaaccggtgactcgtaccggacgccgtggatctacggg
cagtgcaccgaggggctggacgacgccgcccgccaactccaccgctgggagcggacgctg
cccgcccaccccgacgtcgagcgcccggtgagcctcaatgtgtgggaggcggtgtacttc
aaccacgatctgccgaccctgacggccctggccgagcgggcggcgtcgatcggggtggag
cggttcgtgctcgacgacggctggttcaagggccggcgcaacgaccgggccggcctgggc
gactggaccgtcgacgccgatgtgtggcccggcggcctgcatcccctggtggaccgggtc
cgcgagctcggtatggagttcggcctgtgggtggagcccgagatgatcaatcccgactcc
gatctggcccgtgcccaccccgagtggatcatgcgggcccgcgacgaactgcccgccgag
tggcgccaccagcaggtgctcaacatcacgatcccggcggcctgggagtacctgcacgcg
gccatcggccggctgatcgacgagtacggcatcggctacctcaagtgggaccacaaccgc
gatctcatcgaggccggggacgccggaggacgcgccgtcgtccacgagcagaccctggcc
tgctaccggctgatggacgcgctgcgcgccgaacacccgggcctggagatcgagtcctgc
gcctccggcggcggccggatcgacctggagatgctgacccacgtgcagcgggtctggccc
tcggactgcatcgatccgcacgagcggcagtcgatcatgcgctggacctcccagatcgcc
gccgcggagtacctcggctcgcatatcgcctccccgcgatcccacaccaccgggcgggtc
tccgacctgtccttccgggccggcaccgcgctgtggggccacctcggattcgagtgggat
ctgctggccgcctccgaggaggacctggcgcagctgcggcaatgggtgacgttgttcaag
gcccaccgccctaacctgttctccggtgacatcgtgcgccgcgacgtcgccgacgggtcc
atgtggctgcacggggtggtggcggccgaccggtcctcggcgatgttccagctggcgacg
cgggaacgttctcccttgtcaccgcggggaatgatgccgattcccgggctggatcccgat
cgcacataccgccttcaggcggtcctggtgggggatgggccggacggcctcgtcgccccg
ccgtgggccgccgaggggatcgagctgcccggctcggtactgggccaggtgggggtccac
accccgctgctgaatcccgatcaggtgctcatcctgacggtccgggcggtgtag

DBGET integrated database retrieval system