KEGG   Propionibacterium acidipropionici: PACID_06750Help
Entry
PACID_06750       CDS       T02345                                 

Definition
Zn-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PACID_06750
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_06750
  Lipid metabolism
   00071 Fatty acid degradation
    PACID_06750
  Amino acid metabolism
   00350 Tyrosine metabolism
    PACID_06750
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PACID_06750
   00626 Naphthalene degradation
    PACID_06750
Enzymes [BR:pbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PACID_06750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767768..768778
Genome map
AA seq 336 aa AA seqDB search
MRSWQVTDPAPIDSDPAPLQLVERPVPEPAAGEVLVQVLACGVCRTDLHVAEGDLPVHRA
HVTPGHEIVGRVVGFGKGTGRFAPGDRIGIPWLRRTCGVCSYCRSGRENLCSRSSYTGWD
HDGGYAEYATVPEGFAYRIPDRYDPATAAPLLCAGIIGYRALRRAEVPAGGRLGLYGFGG
SAHITAQIALAQGVEVHVFTRGARARTFALELGAASAGGSGDPALVPLDSAIIFAPAGQI
VPRALENLAPGGTLALAGIHMSDVPPLDYQNHLFHEKRLTSVESNTRRDGEEFLTLADRL
DIDPKVTSYPLERADEALRHLGHGDMTGAGVLSISE
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcatggcaggtcactgatcccgcgccgatcgactccgatccggcgccgctgcag
ttggtggagcgtccggtcccggagcccgcggcgggggaggtgctcgtccaggtgctggcc
tgcggagtgtgccgtaccgatctgcacgtggccgagggcgacctgccggtgcaccgggcg
cacgtgacgcccggccacgagatcgtgggacgggtggtgggtttcggcaaggggaccgga
cggttcgccccgggcgaccggatcggcatcccgtggctgcgcaggacctgtggcgtctgc
tcctactgccggtcgggccgggagaacctgtgctcccggtccagctacaccgggtgggat
cacgacggcggctacgccgaatacgcgaccgtccccgaggggttcgcctaccgcatcccc
gaccgttacgacccggcgaccgccgcccctctgctgtgcgccgggatcatcgggtaccgg
gccctgcgccgcgccgaggtgcccgccgggggccggctcgggctctacggattcggcggt
tcggcgcacatcaccgcgcagatcgcgctggcccagggcgtggaggtccacgtcttcaca
cgcggggcccgggcccgtacgttcgcgctcgagctgggcgccgcatcggccggcggcagt
ggcgacccggcactggtgccgctggactcggccatcatcttcgccccggccgggcagatc
gttcctcgcgcgctggagaacctggccccgggtggaacactggcgctggccggcatccac
atgagcgacgtcccgccgctggactaccagaaccacctgttccatgagaagaggctgacc
agcgtcgagtcgaacactcgtcgcgacggcgaggagttcctcaccctcgccgaccggctc
gacatcgacccgaaggtcacgtcgtacccgctcgagagggccgacgaggccctcaggcac
ctggggcacggagacatgacgggcgctggcgttctgagcatctccgaatag

DBGET integrated database retrieval system