KEGG   Propionibacterium acidipropionici: PACID_06900Help
Entry
PACID_06900       CDS       T02345                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pbo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pbo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pbo00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780939..783065
Genome map
AA seq 708 aa AA seqDB search
MGVIHLHRGGTSVLLETGGPGLPRILHIGEELVLAPDADLDALAAALIPPVVSDSTDEPP
RRSVMPEASAGWLGTPGISGDFDGLHALTHMVLDGVDAGGAAATVRAHDDRLNLTWQILL
SAGGLAQIRAVLTNTSRTPFRLAATDLSIPAGDEATELLSLEGRHLRERHPQRSSFIVGH
TEFATRRGRTGLQAPTLLMAGEPGFDFDRGRIWAIHLGWSGNQRIWAERGHDGPAALGGG
ELIMPGEIRLGPGDSYTSPWLFASHGTGVDQVAARFHDWLRATPGRATRPRPVTLNTWEA
VYFDQNLADLSELARLAGSVGVERFVLDDGWFGARRDDSAGLGDWTVSPEMWPEGLDPLI
DAVRSQGMEFGLWVEPEMVSADSELARLHPDWILGESGHTPMPARHQQVLDLANPDAWAY
IHAALDALLTRYSIGYLKWDNNRDIHEPVDPRGAGRAHAQVDAFYRLVDRLRADHPGLEI
ESCSSGGGRVDLEVLSRTDRIWVSDCIDPMERQTIQTWTSALVPPELMGCHIGAPVSHTT
GRTHSLATRATTALLGHLGVEWDLRDASEADLAALSGWIAIHKRLRGLISTGRLLHRAGP
TRTVTALVSRDAATAAVVVAQTATGNRYPAEPLRIPGLDAARTYRLTAHGVEGHLLPPWL
ADGTSPELPGSLLTGVGVAAPELPPENSWLLVVEDASQASGQNRKETT
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatccacctacatcgcggcggcacctccgtgctgctcgagaccgggggaccc
ggcctcccgcgcatcctccacatcggcgaggagctggtactggctcccgacgccgatctg
gacgctctggccgctgctctgatcccgccggtcgtcagcgattccaccgacgagccgccc
cggcgctcggtgatgcccgaagcctccgccggatggctcggcaccccggggatcagcggc
gacttcgacggcctccacgcgctgacgcacatggtgctcgacggcgtcgacgccggcggc
gccgccgcaaccgtgcgggcccacgacgaccggctgaacctcacctggcagatcctgctg
tcggccggcgggctggcgcagatccgggccgtcctcaccaacacctcgaggacgccgttc
cggctcgccgccaccgacctgtcgatcccggccggggacgaggccaccgagctgctcagc
ctggagggccgccacctgcgtgaacgccacccccagcgcagctccttcatcgtcggtcac
acggagttcgccacccgccgcggacgcaccggcctccaggcccccaccctcctgatggcc
ggtgagcccggcttcgacttcgaccgggggaggatctgggcgatccacctgggatggtcc
ggcaaccagcggatctgggccgaacgcggccacgacggcccagcggccctgggcggcggg
gagctgatcatgcccggtgagatccgtctggggccgggggactcctacacctccccgtgg
ctcttcgcatcccacggcaccggcgtcgaccaggtggcggcccggttccacgactggctg
cgcgcgacaccggggcgcgccacccggccccgcccggtgacgctcaacacctgggaggcc
gtgtacttcgaccagaacctcgccgacctctccgaactggcgaggctggccggcagcgtc
ggcgtcgagagattcgtcctggacgacggctggttcggggcccgtcgcgacgactcggcc
gggctcggggactggaccgtttcacccgagatgtggcccgagggcctcgaccccctcatc
gacgccgtccgaagccaaggcatggagttcggcctgtgggtcgaacccgagatggtcagc
gcggactccgagctggcccgcctccaccccgactggatcctgggggagagcgggcacacc
cccatgcccgctcgacaccagcaggtcctcgacctggccaaccccgacgcctgggcgtac
atccacgcggccctggacgccctgctgacccggtactccatcggctacctcaagtgggac
aacaaccgcgacatccacgaacccgtcgacccccgaggggcaggacgggcgcacgcgcag
gtcgacgcgttctaccgtctcgtcgaccggctgcgcgccgaccaccccggcctggaaatc
gagtcctgctcctcgggaggcgggcgggtggacctcgaggtgctctcgcgcaccgaccgg
atctgggtcagcgactgcatcgacccgatggaacgccagaccatccagacctggacctcg
gccttggtgccgcccgaactcatgggctgccacatcggggcacccgtctcccacaccacc
gggcggacgcactccctggccaccagagccacgacggccctcctcggccacctcggcgtc
gaatgggacctgcgcgacgcctccgaagccgatctcgccgcgctgtccggctggatcgcg
atccacaagcggctgcgcggcctcatctccaccggtcggctgctccaccgggcgggcccg
acgcgcaccgtcaccgcactggtctcccgggacgccgccacggcggccgtcgtcgtggcc
cagaccgccaccggcaaccgctacccggccgagccgctgcggatccccgggctggacgcc
gcccgcacctaccgactgaccgcccacggcgtcgagggccatctgctccccccgtggctg
gctgacggcacctccccagaactccccggatcgttgctgaccggggtgggtgtggcagca
cccgaactgccgcccgagaactcctggctcctcgtcgtcgaggacgcctcgcaggcttcc
gggcagaaccgaaaggaaaccacatga

DBGET integrated database retrieval system