KEGG   Propionibacterium acidipropionici: PACID_06960Help
Entry
PACID_06960       CDS       T02345                                 

Definition
aldose 1-epimerase (EC:5.1.3.15)
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PACID_06960
Enzymes [BR:pbo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PACID_06960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(788774..789625)
Genome map
AA seq 283 aa AA seqDB search
MGTAVTSPATPLPGELLDRHEGRWLIADHGSQVLAWQPLDGDRRPVLWYDSADPQELPGV
IRGGVPICAPWFGHGPDDDQDPQHGLARLSAFDREVLLDGPRFLLVRHTVDPEELGAPFR
LVHTVEMTGGSMTLNLEATCTDTVPRRFEAVWHSYFRVGDAARATVTGVEGAAWHNHATG
DAGALASDSLPIAPDTDTVLQGSQEALSVVDPAWGRRIDVDTQGCPTAVVWNPRMRSGTR
TDLTGRSWRDFVCLETGTAKENALVLEPGQDTSLHMRVSLSTL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgggcacggccgtgacctcccccgcgacaccccttccgggggagctgctcgaccgccac
gagggccgctggctgatcgccgaccacggctcccaggtcctggcctggcagccgctggac
ggcgaccggcgcccggtgctctggtacgactccgccgatccgcaggaactgcccggtgtg
atccgcggcggcgtcccgatctgcgccccgtggttcggccatggacccgacgacgatcag
gacccccagcacggcctcgcccgactgtccgccttcgaccgcgaggtgctgctggacggg
ccccgcttcctcctggtgcgccacaccgtcgaccccgaggagctgggagcgccgttccgg
ctcgtgcacaccgtcgagatgaccggcggctcgatgaccctcaatctggaggccacctgc
accgacaccgtcccgcgccgcttcgaggccgtatggcactcctacttccgggtcggggac
gccgcccgggcgacggtgaccggggtcgagggggccgcctggcacaaccacgccaccggc
gacgccggggcactggcctccgactccctgccgatcgccccggacactgacaccgtgctc
cagggatcccaggaagcgctgtcggtggtcgatccggcatggggccggaggatcgacgtc
gacacccagggatgccccaccgccgtggtgtggaacccgcggatgaggtcgggcacccgc
accgacctcaccggccggtcatggcgggacttcgtctgcctggagacgggcaccgccaag
gagaacgcgctggtgctggaacccggtcaggacaccagcctgcacatgagggtgagcctc
agcaccttgtaa

DBGET integrated database retrieval system