KEGG   Propionibacterium acidipropionici: PACID_09890Help
Entry
PACID_09890       CDS       T02345                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pbo00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092106..1093017
Genome map
AA seq 303 aa AA seqDB search
MTVRASAKVNLALGVGPRAEDGFHPLATVFEAVGLHDTITAGPRDDDVIAVTVEGPEADL
VPTDESNLAYRAAELLRSRCADPHLGVDLHITKSIPVAGGMAGGSADAAGALLACSVLWD
IDAGPGDLHDLAAELGSDVPFALIGGVALGRGRGDRLVPVIFRGTHHWVFATSEEGLSTP
AVYRRFDELGGGGGDLVPTALIAALTRGDIDAVAGGLGNDLQEAALDLRPELAGVLEAGV
EAGAMAGLVSGSGPTVAFLVGGEAIGRTVAKTLRTLPQVSSVRGARGPAQGAQLMAGTLE
AGS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgagggcctcggccaaggtgaacctggcgctgggagtcggcccgcgggcagag
gacggattccacccgctggccaccgtcttcgaggccgtcggactccacgacacgatcacc
gccgggccgcgcgacgacgacgtcatcgctgtcaccgtggagggccccgaggccgacctg
gtaccgaccgacgagtcgaacctggcctaccgggcggccgaactgctgcggtcccggtgc
gccgatccgcacctgggggtcgacctccacatcaccaagtcgatcccggtcgccgggggc
atggccggtggatccgccgacgccgccggggcgctgctggcctgctcggtgctgtgggac
atcgacgccggccccggcgacctccacgacctggccgcggaactgggctccgacgtgccc
ttcgcgctcatcggcggggtggcgctgggccggggccgcggcgaccgactcgtcccggtg
atcttccggggcacccaccactgggtcttcgccacctcggaggagggactgtcgacgccg
gcggtctaccggaggttcgacgagctgggcggcggcgggggagacctcgtgcccaccgcc
ctcatcgcggccctcaccaggggggatatcgacgcggtcgccggggggctgggcaacgac
ctgcaggaggccgccctggaccttcgacccgagctggcaggggtgctggaggccggtgtc
gaggcgggggcgatggccggactggtctccggatcggggccgacggtggccttcctggtc
ggcggggaggcgatcggcaggacggtggccaagaccttgcggacgctgccgcaggtgagc
tcggtgcgaggtgccaggggccccgcccagggggcccagctgatggccggcaccctcgag
gcggggagctga

DBGET integrated database retrieval system