KEGG   Propionibacterium acidipropionici: PACID_09890Help
Entry
PACID_09890       CDS       T02345                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PACID_09890
Enzymes [BR:pbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PACID_09890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1092106..1093017
Genome map
AA seq 303 aa AA seqDB search
MTVRASAKVNLALGVGPRAEDGFHPLATVFEAVGLHDTITAGPRDDDVIAVTVEGPEADL
VPTDESNLAYRAAELLRSRCADPHLGVDLHITKSIPVAGGMAGGSADAAGALLACSVLWD
IDAGPGDLHDLAAELGSDVPFALIGGVALGRGRGDRLVPVIFRGTHHWVFATSEEGLSTP
AVYRRFDELGGGGGDLVPTALIAALTRGDIDAVAGGLGNDLQEAALDLRPELAGVLEAGV
EAGAMAGLVSGSGPTVAFLVGGEAIGRTVAKTLRTLPQVSSVRGARGPAQGAQLMAGTLE
AGS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgagggcctcggccaaggtgaacctggcgctgggagtcggcccgcgggcagag
gacggattccacccgctggccaccgtcttcgaggccgtcggactccacgacacgatcacc
gccgggccgcgcgacgacgacgtcatcgctgtcaccgtggagggccccgaggccgacctg
gtaccgaccgacgagtcgaacctggcctaccgggcggccgaactgctgcggtcccggtgc
gccgatccgcacctgggggtcgacctccacatcaccaagtcgatcccggtcgccgggggc
atggccggtggatccgccgacgccgccggggcgctgctggcctgctcggtgctgtgggac
atcgacgccggccccggcgacctccacgacctggccgcggaactgggctccgacgtgccc
ttcgcgctcatcggcggggtggcgctgggccggggccgcggcgaccgactcgtcccggtg
atcttccggggcacccaccactgggtcttcgccacctcggaggagggactgtcgacgccg
gcggtctaccggaggttcgacgagctgggcggcggcgggggagacctcgtgcccaccgcc
ctcatcgcggccctcaccaggggggatatcgacgcggtcgccggggggctgggcaacgac
ctgcaggaggccgccctggaccttcgacccgagctggcaggggtgctggaggccggtgtc
gaggcgggggcgatggccggactggtctccggatcggggccgacggtggccttcctggtc
ggcggggaggcgatcggcaggacggtggccaagaccttgcggacgctgccgcaggtgagc
tcggtgcgaggtgccaggggccccgcccagggggcccagctgatggccggcaccctcgag
gcggggagctga

DBGET integrated database retrieval system