KEGG   Acidipropionibacterium acidipropionici ATCC 4875: PACID_11650Help
Entry
PACID_11650       CDS       T02345                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pbo  Acidipropionibacterium acidipropionici ATCC 4875
Pathway
pbo00300  Lysine biosynthesis
pbo01100  Metabolic pathways
pbo01120  Microbial metabolism in diverse environments
pbo01230  Biosynthesis of amino acids
Module
pbo_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PACID_11650 (dapE)
Enzymes [BR:pbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PACID_11650 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: AFV88989
UniProt: K7RM14
Position
1278804..1279889
Genome map
AA seq 361 aa AA seqDB search
MMLDLRGDLRTLFTQIVDCESVSGHEEVLAGLVEKALTDLPHLETVRIGNNLVARTGLGR
RERVLVAGHLDTVPVAGNLPSVRETREDGEYLVGRGSCDMKGGVAVALSLAAQLDSPAKD
VTWVFYDCEEIAAQYNGLGRIAAERPELLDADLAVLMEPTDGVVEGGCQGTMRFTLHVPG
TAAHSARSWTGHNAIHDLAPILDILRDWQRRDPLVDVDGLTYHEGLNATMVSGGLAGNVI
PPEATIQINYRYAPDKTAAQAEASMRALFDGWAMEVLDLSAPARPGLDRALARSFVEKVG
TEPRPKYGWTDVARFSELGTPALNYGPGDPLCAHKADECCRLETLDECRAALGGWLAEED
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggatctgcgaggcgacctccgcaccctgttcacacagatcgtcgactgcgag
tcggtgagtggccacgaggaggtcctcgccgggctggtcgagaaggccctgacggatctg
ccccaccttgagaccgtgaggatcggcaacaatctggtcgctcggaccggcctcggccgc
cgggagagggtgctggtggccggtcacctggacaccgtgccggtcgccgggaacctgccg
agcgtgcgcgagacgcgcgaggacggcgagtatctggtggggcggggcagctgcgacatg
aagggcggagtcgccgtcgccctgtccctggcggcacagttggacagcccggccaaggac
gtcacctgggtcttctacgactgcgaggagatcgcggcgcagtacaacggcctaggccgc
atcgccgccgagcggcccgagcttctggacgccgacctggcggtcctcatggagcccacc
gacggcgtcgtggagggagggtgccagggcaccatgagattcaccctccacgtgccgggg
accgcggcccactccgcacgctcctggaccgggcacaacgccatccacgatctcgcaccg
atcctcgacatcctgcgcgactggcagcgtcgcgatccgctcgtcgacgtcgacgggctc
acctaccacgaggggctcaacgcgaccatggtctccggcgggctggccggcaacgtcatc
ccccccgaggcgacgatccagatcaactaccggtacgcgccggacaagaccgccgcgcag
gccgaggcctccatgcgggccctgttcgacggctgggccatggaggtgctggacctctca
gcccccgcgaggccgggcctcgacagggcactggcccggtccttcgtcgagaaggtcggc
accgagccgcggcccaagtacggctggaccgatgtggcacggttctccgaactggggacg
ccggctctcaactacgggcccggtgacccgctgtgcgcccacaaggccgacgagtgctgc
cgtcttgagacccttgacgagtgccgcgccgctctgggcggctggctggcggaggaggac
tcatga

DBGET integrated database retrieval system