KEGG   Propionibacterium acidipropionici: PACID_11840Help
Entry
PACID_11840       CDS       T02345                                 

Definition
Uroporphyrinogen-III synthase domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PACID_11840
Enzymes [BR:pbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PACID_11840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295474..1296259
Genome map
AA seq 261 aa AA seqDB search
MTAQRRADDLAAPLVRRGAEVVIAPTLAVEKHIDEPVLLDQTRALISDPPQILIITTGFG
LRAWNESAIGAGLGEQLVGMLNSTRVLARGPKASGALQQIGSRAAWVAASELSDEILRTL
VAEGVDGVQIAVQLDGGGDPGLLAGLRDAGARVIELPVYRWGPPADPEAVARAAVDAGAG
RYDAVAFTAAPGAAAWVDSLRRAGTLEAVRDLVDRDALRLVAVGARCAEPLAAAGQAARW
PERSRLGPLTKLIAEGVSQAD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccagcggcgggccgacgacctggcggcgcccctggtccggcgcggcgccgag
gtggtcatcgcaccgaccctggccgtcgagaagcacatcgatgaaccggtgctgctcgac
cagacccgggcgctgatatccgacccgccgcagatcctcatcatcaccaccggattcggg
ctgcgcgcatggaacgagtcggcgatcggcgccggcctcggcgagcagctcgtcgggatg
ctcaacagcacacgggtgctggcccgcggccccaaggcctccggcgccctccagcagatc
ggatcgcgggccgcctgggtggccgcctcggaactgtccgacgagatcctgcggacgctg
gtggccgagggggtcgacggcgtccagatcgccgtccagctcgacggcgggggagacccc
ggcctgctcgccgggctgcgtgatgccggggcccgagtcatcgagctgcccgtctaccgc
tgggggccgcccgccgatcccgaagcggtggcccgagccgccgtcgacgcgggagcagga
cgctatgacgccgtcgccttcaccgcggcgccgggggccgccgcctgggtggactcgctg
cgccgggccgggactctcgaggcggtgcgggatctcgtggaccgggacgccctgagactg
gtggcggtcggggcccggtgcgcagagccgctggcggccgcggggcaggcggcccggtgg
ccggagcgcagcaggctcggaccactgacgaaactcatcgctgaaggcgtatcacaggct
gactag

DBGET integrated database retrieval system