KEGG   Propionibacterium acidipropionici: PACID_12130Help
Entry
PACID_12130       CDS       T02345                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PACID_12130
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PACID_12130
  Amino acid metabolism
   00310 Lysine degradation
    PACID_12130
Enzymes [BR:pbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PACID_12130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1330047..1331405)
Genome map
AA seq 452 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKSVGDTVEADEPLLEVSTDKVDTEVPSPVSGTLLEIR
VNEDDDAAVGSVLAVIGDPAPAAPEPAPAPAAPPAPAPTPAPAPAAPAPAAPAAPAPAAP
PSAGANEVAPRATSPSADVYVTPLVRKLAKENGVDLSTLTGTGVGGRIRKQDVLAAAEKA
KAPAPAPAAPAAPAAPAAGSAKAAAQAVSAEADALRGTTEKMSRLRKVIASRMVESLHIS
AQLTATVEVDMTAISRIRRAEKAAFKAREGVGLSYLPFITKAIVEALKQNPKFNARIDTE
AGTITYGATENVGIAVDTPRGLVVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVTPDELS
GGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAIRDMMYLSL
SYDHRLIDGAVAARFLTGVKNRLEEGDFSGEF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactctcccggcactcggcgaatcagtcaccgagggcaccgtgtcc
cgctggctcaagtccgtcggagacaccgtcgaggccgacgagccactcctcgaggtgtcc
accgacaaggtcgacaccgaggtcccctcccccgtctccggcaccctcctggagattcgc
gtcaacgaggacgacgacgcagccgtcggctccgtcctggccgtcatcggcgaccccgcc
cccgcagcccccgagccggcaccggccccggcagctccccccgcacccgcaccgaccccg
gctcccgcaccggcagcacccgcccccgcagcgccggcggctcctgctcccgcggcgccc
ccgtcggcgggcgccaatgaggtggctccccgggcgaccagcccctcggccgatgtctac
gtcaccccgctggtgcgcaagctcgccaaggagaacggcgtcgacctgtccaccctcacc
ggcaccggcgtcggaggccgtatccgcaagcaggacgtgctggccgccgccgagaaggcc
aaggcccccgcaccggcccctgccgcacctgcagcccccgccgcgccggccgccgggtcg
gcgaaggccgcggcccaggctgtgtcggcggaggccgacgcgctgcgcggcaccaccgag
aagatgagccggcttcgcaaggtgatcgcctcgcggatggtggagtcgctgcacatctcg
gcccagctcaccgcgaccgtcgaggtcgacatgaccgcgatctcgcgtatccgcagggcg
gagaaggcggccttcaaggcccgggagggcgttgggctgtcctacctgcccttcatcacc
aaggccatcgtcgaggcgctcaagcagaacccgaagttcaacgcccggatcgacaccgag
gccgggaccatcacctacggggccaccgagaacgtcgggatcgctgtcgacacaccccgc
ggcttggtcgtgccggtgatcaagaacgccggagacctgaacatcgccggcctcgcccac
cagatcggcgatctggcggccaggacccgcgacaacaaggtgactcccgatgagctgtcc
ggcggcaccttcacgatcaccaactacgggtcggccggggcgctgttcgacaccccgatc
gtcaaccagcccgaggtcgcgatcctcggtaccggcgccctggtgaagcggccggtcgtg
gtcaccaacgagttcggcgaggacaccatcgcgatccgcgacatgatgtacctgtcgctg
agctacgaccaccgcctcatcgacggcgccgtcgcggcccgattcctcaccggcgtcaag
aaccggctcgaggagggcgacttctccggcgagttctga

DBGET integrated database retrieval system