KEGG   Propionibacterium acidipropionici: PACID_12130Help
Entry
PACID_12130       CDS       T02345                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbo  Propionibacterium acidipropionici
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PACID_12130
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PACID_12130
  Amino acid metabolism
   00310 Lysine degradation
    PACID_12130
Enzymes [BR:pbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PACID_12130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1330047..1331405)
Genome map
AA seq 452 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKSVGDTVEADEPLLEVSTDKVDTEVPSPVSGTLLEIR
VNEDDDAAVGSVLAVIGDPAPAAPEPAPAPAAPPAPAPTPAPAPAAPAPAAPAAPAPAAP
PSAGANEVAPRATSPSADVYVTPLVRKLAKENGVDLSTLTGTGVGGRIRKQDVLAAAEKA
KAPAPAPAAPAAPAAPAAGSAKAAAQAVSAEADALRGTTEKMSRLRKVIASRMVESLHIS
AQLTATVEVDMTAISRIRRAEKAAFKAREGVGLSYLPFITKAIVEALKQNPKFNARIDTE
AGTITYGATENVGIAVDTPRGLVVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVTPDELS
GGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAIRDMMYLSL
SYDHRLIDGAVAARFLTGVKNRLEEGDFSGEF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactctcccggcactcggcgaatcagtcaccgagggcaccgtgtcc
cgctggctcaagtccgtcggagacaccgtcgaggccgacgagccactcctcgaggtgtcc
accgacaaggtcgacaccgaggtcccctcccccgtctccggcaccctcctggagattcgc
gtcaacgaggacgacgacgcagccgtcggctccgtcctggccgtcatcggcgaccccgcc
cccgcagcccccgagccggcaccggccccggcagctccccccgcacccgcaccgaccccg
gctcccgcaccggcagcacccgcccccgcagcgccggcggctcctgctcccgcggcgccc
ccgtcggcgggcgccaatgaggtggctccccgggcgaccagcccctcggccgatgtctac
gtcaccccgctggtgcgcaagctcgccaaggagaacggcgtcgacctgtccaccctcacc
ggcaccggcgtcggaggccgtatccgcaagcaggacgtgctggccgccgccgagaaggcc
aaggcccccgcaccggcccctgccgcacctgcagcccccgccgcgccggccgccgggtcg
gcgaaggccgcggcccaggctgtgtcggcggaggccgacgcgctgcgcggcaccaccgag
aagatgagccggcttcgcaaggtgatcgcctcgcggatggtggagtcgctgcacatctcg
gcccagctcaccgcgaccgtcgaggtcgacatgaccgcgatctcgcgtatccgcagggcg
gagaaggcggccttcaaggcccgggagggcgttgggctgtcctacctgcccttcatcacc
aaggccatcgtcgaggcgctcaagcagaacccgaagttcaacgcccggatcgacaccgag
gccgggaccatcacctacggggccaccgagaacgtcgggatcgctgtcgacacaccccgc
ggcttggtcgtgccggtgatcaagaacgccggagacctgaacatcgccggcctcgcccac
cagatcggcgatctggcggccaggacccgcgacaacaaggtgactcccgatgagctgtcc
ggcggcaccttcacgatcaccaactacgggtcggccggggcgctgttcgacaccccgatc
gtcaaccagcccgaggtcgcgatcctcggtaccggcgccctggtgaagcggccggtcgtg
gtcaccaacgagttcggcgaggacaccatcgcgatccgcgacatgatgtacctgtcgctg
agctacgaccaccgcctcatcgacggcgccgtcgcggcccgattcctcaccggcgtcaag
aaccggctcgaggagggcgacttctccggcgagttctga

DBGET integrated database retrieval system